Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29854 produtos de "Peptídeos"
Melanocyte Associated Antigen gp 100 (17 - 25)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C38H70N10O11Peso molecular:843.04 g/molH-LDAQASFLPK^-OH
Peptide H-LDAQASFLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVTEQGAELSNEER^-OH
Peptide H-AVTEQGAELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 69
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,794.2 g/molH-GSISIQTEEQIHGK^-OH
Peptide H-GSISIQTEEQIHGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SALVNEYNVDASR^-OH
Peptide H-SALVNEYNVDASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTDVQAWIR^-OH
Peptide H-GTDVQAWIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDALNETR^-OH
Peptide H-EDALNETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-VPFA
Peptide Fmoc-VPFA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QVSDLISVLR^-OH
Peptide H-QVSDLISVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tertiapin-Q trifluoroacetate salt
CAS:A peptide found in honey bee venom; Potassium channel inhibitorFórmula:C106H175N35O24S4Pureza:Min. 95%Peso molecular:2,452.01 g/molBiot-PPPPPP
Peptide Biot-PPPPPP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tyrosinase precursor (1-9)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-AEDVCDLP-NH2
Peptide H-AEDVCDLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Vitamin D Receptor (VDR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VVGARGVGK^-OH
Peptide H-VVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVSSENFDDYMK^-OH
Peptide H-LVSSENFDDYMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 84
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,613 g/molH-AHVQVVDSNGNR^-OH
Peptide H-AHVQVVDSNGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DISEMFLQIYK^-OH
Peptide H-DISEMFLQIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Val-Ile-Pro
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C16H29N3O4Peso molecular:327.42 g/molpE-RPRLSHKGPMP-OH
Peptide pE-RPRLSHKGPMP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AQTAHIVLEDGTK^-OH
Peptide H-AQTAHIVLEDGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LTRIV-NH2
Peptide Ac-LTRIV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^EQAPNLVY-OH
Peptide H-R^EQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIFGLFGK^-OH
Peptide H-VIFGLFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino ]-4-oxobutanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C43H68N12O16Peso molecular:1,009.09 g/molH-YLVIQGDER^-OH
Peptide H-YLVIQGDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV env (335 - 343)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C56H84N10O11Peso molecular:1,073.35 g/molH-GTVSGTL^^IGLEFIR-OH
Peptide H-GTVSGTL^^IGLEFIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RADARADARADARADA-NH2
Peptide Ac-RADARADARADARADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH
H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C200H377N125O51Peso molecular:5,349 g/molH-SYDL^DPGAGSLEI^-OH
Peptide H-SYDL^DPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGLDAASYYAPVR^-OH
Peptide H-DGLDAASYYAPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPQTPLHTSR^-OH
Peptide H-VPQTPLHTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHDGLYQGLSTATK^-OH
Peptide H-GHDGLYQGLSTATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Dap-OtBu hydrochloride salt
CAS:Boc-Dap-OtBu hydrochloride salt is a chemical that is synthesized by anhydride and trifluoroacetic acid. It can be used in the laboratory for protein visualization, as well as to detect proteins using LC-MS. The presence of trifluoroacetic acid makes the Boc-Dap-OtBu hydrochloride salt fluorescent, which makes it possible to visualize the reaction products under UV light. This chemical is often used in fluorescence spectrometry to identify amino acids and other compounds.Fórmula:C12H24N2O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:260.33 g/molH-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNSAAFPAPIEK^-OH
Peptide H-VNSAAFPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 33
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,503.6 g/molH-EFTPVL^QADFQK-OH
Peptide H-EFTPVL^QADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Trp-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in the synthesis of peptides. It is an alcohol and amine-containing resin which is typically used as a building block for peptide synthesis. The H-Trp side chain in this resin can be cleaved with thiols to yield a free Trp residue.Pureza:Min. 95%Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Ile-Glu-Pro-Asp-AMC
CAS:AMC conjugated molecule targeting caspase-8 and granzyme B
Fórmula:C32H41N5O11Pureza:Min. 97 Area-%Cor e Forma:PowderPeso molecular:671.7 g/molH-RCGPDCFDNYGRYKYCF-NH2
Peptide H-RCGPDCFDNYGRYKYCF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Glu(Tyr-OH)-OH
CAS:H-Glu(Tyr-OH)-OH is an amino acid analogue that has been shown to have natriuretic effects. It also has anti-inflammatory and analgesic properties, which are likely due to its ability to inhibit the bacterial enzyme arginase. H-Glu(Tyr-OH)-OH is a part of a class of compounds called oximes, which are used in the treatment of poisoning by organophosphates, pyrethroid insecticides, and carbamates. The compound is synthesized by treating L-glutamic acid with hydrogen peroxide and tyrosine in acidic conditions. H-Glu(Tyr-OH)-OH has also been found to have a protective effect on alcohol induced damage in rats. This may be due to its ability to increase the synthesis of dopamine, which is involved in the regulation of blood pressure and water balance.Fórmula:C14H18N2O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:310.3 g/molMyelin Basic Protein (111-129)
The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur and theses occurrences can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways. Although more research needs to be carried out, it is thought that MBP significantly contribute to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models. One-Letter Formula: LSRFSWGAEGQRPGFGYGGFórmula:C92H129N27O26Pureza:Min. 95%Peso molecular:2,029.22 g/molH-AGENTK^-OH
Peptide H-AGENTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,582.9 g/mol5Fam-EEPLYWSFPAKKK-NH2
Peptide 5Fam-EEPLYWSFPAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLGR-CMK
Peptide Ac-SLGR-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSESGELHGLTTEEEFVEGIYK^-OH
Peptide H-TSESGELHGLTTEEEFVEGIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NGNNVNGNRNNN-NH2
Peptide H-NGNNVNGNRNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVLEVAQHLGESTVR^-OH
Peptide H-LVLEVAQHLGESTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRV^YI^-OH
Peptide H-DRV^YI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RHPDYSVVLLLR^-OH
Peptide H-RHPDYSVVLLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDVDTLDMVFLDHWK^-OH
Peptide H-YDVDTLDMVFLDHWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLSLSLGK^-OH
Peptide H-SLSLSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotinylated Vn96 peptide, patent WO 2012/126118
A kit for releasing EVs from their bound state with the Vn96 peptide.Pureza:Min. 95%H-LVVVGACGVGK^-OH
Peptide H-LVVVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BMP 4 Human
BMP 4 Human is a recombinant human protein that is a member of the TGF-β superfamily. It interacts with Ligand, Receptor, and Activator and has been shown to inhibit Ion channels in vitro. BMP 4 Human is a research tool for studying signaling pathways in pharmacology and cell biology.Pureza:>95% By Sds-Page And Rp-HplcAc-CHIKKMVGDYDRRA-OH
Peptide Ac-CHIKKMVGDYDRRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKLVFF-NH2
Peptide H-CKLVFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GP120 - W61D - 18
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,578.7 g/molHXB2 gag NO-23/aa89 - 103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,824.1 g/molSIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,845.2 g/molH-LFDSLTLLASGR^-OH
Peptide H-LFDSLTLLASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLDFHDSNVK^-OH
Peptide H-TLDFHDSNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVLTIDKK^-OH
Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHLVEALYLVCGERG-NH2
Peptide H-SHLVEALYLVCGERG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro-OH
Peptide H-Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:758.75 g/molH-NKPQFLAGAASLLR^-OH
Peptide H-NKPQFLAGAASLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB
Please enquire for more information about Fmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%H-GGVEVLEVK^-OH
Peptide H-GGVEVLEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGDTSLDPNDFDFTVTGR^-OH
Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^PGFSPF-OH
Peptide H-RP^PGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CFTR (108-117), Pseudomonas aeruginosa Inhibitor
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C51H77N15O22Peso molecular:1,252.27 g/molH-VEEVSLRK^-OH
Peptide H-VEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-RRR-OH
Peptide Boc-RRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VGAVPG-NH2
Peptide Ac-VGAVPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAVPSGASTGIYEALELR^-OH
Peptide H-AAVPSGASTGIYEALELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Caspase-5-derived FSP (67-75)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH
Peptide LCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MAGEA-10 254-262 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FPLTNA^IK^-OH
Peptide H-FPLTNA^IK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLTDYLMK^-OH
Peptide H-DLTDYLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAVAIK^-OH
Peptide H-LAVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNIL^R^-OH
Peptide H-NNIL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDAPI^GK-OH
Peptide H-SDAPI^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPVVSGDTSPR^-OH
Peptide H-SPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HCV NS5a 2266-2275 (HLA-B*40:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TIDYFQPNNK^-OH
Peptide H-TIDYFQPNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFQALGDAADIR^-OH
Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5TAMRA-LKRYKRRL-OH
Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSFISEGEIK^-OH
Peptide H-LSFISEGEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 113 (GVMTRGRLKAESTVA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,575.9 g/molLCBiot-LVVVGACGVGK-OH
Peptide LCBiot-LVVVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFDSFGDLSSASAIMGNAK^-OH
Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SLC6A14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A14 antibody, catalog no. 70R-6568Pureza:Min. 95%TMSB4Y (Human) Recombinant Protein
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-LVAYYTLIGASGQR^-OH
Peptide H-LVAYYTLIGASGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Amyloid β-Protein (1-16)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C84H119N27O28Peso molecular:1,955 g/molInfluenza Virus A/Aichi/2/68 Haemagglutinin HA1 (195-209), X-31
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,666.9 g/molH-VEHWGLDKPLLK^-OH
Peptide H-VEHWGLDKPLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Lys-Lys-Lys-Lys-Lys-OH
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C30H62N10O6Peso molecular:658.89 g/molH-TISSEDKPFNLR^-OH
Peptide H-TISSEDKPFNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-SGRPRTTSFAESCKP-NH2
Peptide Biot-SGRPRTTSFAESCKP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2
Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Z-Gly-Met-OH
CAS:Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.Fórmula:C15H20N2O5SPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:340.4 g/molH-IRPFF^PQ-OH
Peptide H-IRPFF^PQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
α-CGRP (mouse, rat)
CAS:Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion. It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.Fórmula:C162H262N50O52S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:3,806.25 g/molH-CR-NH2
Peptide H-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDYDLNAVR^-OH
Peptide H-GDYDLNAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSAPGSQR^-OH
Peptide H-LSAPGSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ubiquitin Carboxyl-Terminal Esterase L3 , human, recombinant
Ubiquitin carboxyl-terminal esterase L3 is a type of enzyme that activates ubiquitin by removing a carboxyl-terminal residue. It is an activator of the receptor for epidermal growth factor (EGF). Ubiquitin carboxyl-terminal esterase L3 interacts with EGF receptors, which are involved in cell proliferation, differentiation and apoptosis. This protein also has been shown to inhibit ion channels and bind to antibodies.Pureza:Min. 95%H-Gly-Pro-pNA•hydrochloride
CAS:H-Gly-Pro-pNA is an antidiabetic drug that inhibits the activity of dipeptidyl peptidase IV (DPP IV), a family of enzymes that catalyses the cleavage of the amino acid sequence of proline and arginine. The inhibitory effect on DPP IV by H-Gly-Pro-pNA was demonstrated using magnetic resonance spectroscopy, chromatographic assays, and electrospray ionization mass spectrometry. H-Gly-Pro-pNA also has hydrophobic properties and can interact with other drugs that are lipophilic. In vitro assays have been used to determine the inhibition activity of H-Gly-Pro-pNA against various proteins involved in diabetes mellitus, including aminopeptidases, carboxypeptidases and endopeptidases.Fórmula:C13H16N4O4•HClPureza:Min. 95%Cor e Forma:White PowderPeso molecular:328.75 g/molH-FLRPGDDSSHDLMLLR^-OH
Peptide H-FLRPGDDSSHDLMLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-82/aa325 - 339
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,554.8 g/molH-DANISQPETTK^-OH
Peptide H-DANISQPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQYNSTYR^-OH
Peptide H-EEQYNSTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVEIGSFLLGR^-OH
Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMLDL^QPETT-OH
Peptide H-YMLDL^QPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIVQNLR^-OH
Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSLTLPALR^-OH
Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 124
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,714.9 g/molH-QTISNACGTIGLIHAIANNK^-OH
Peptide H-QTISNACGTIGLIHAIANNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGVPVIK^-OH
Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEEQLTPVAEETR^-OH
Peptide H-SELEEQLTPVAEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TWNDPSVQQDI^K^-OH
Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GYAGTLQSL-NH2
Peptide Ac-GYAGTLQSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TARKSTGGC-NH2
Peptide Ac-TARKSTGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Trp(Boc)-Rink-Amide MBHA Resin
Please enquire for more information about Fmoc-Trp(Boc)-Rink-Amide MBHA Resin including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Rhod-VPMLKE-OH
Peptide Rhod-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-64
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,795.2 g/molPAR-3 (1-6) amide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H46N10O7Peso molecular:646.75 g/molH-LEETVQAK^-OH
Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH
Peptide H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VL^IGLDLLYGELQDSDDF-OH
Peptide H-VL^IGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPV^LDSDGSFFLYSR^-OH
Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGYPITDDLDIYTR^-OH
Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-SIINFEKLGSGHWDFAWPW-OH
Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALLESSLR^QA-OH
Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNSV^IEK-OH
Peptide H-VNSV^IEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-β Amyloid (1-42) Human
Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.Pureza:Min. 95%Cor e Forma:PowderH-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNPESSFNDENLR^-OH
Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolChain A, SARS-CoV-2 spike glycoprotein (902-909)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ELVSEFSR^-OH
Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAPQLSTEELVSLGEK^-OH
Peptide H-IAPQLSTEELVSLGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFEVIETEK^-OH
Peptide H-LFEVIETEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VHVGDEDFVHLR^-OH
Peptide H-VHVGDEDFVHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ANELLINVK^-OH
Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HSQPWQVLVASR^-OH
Peptide H-HSQPWQVLVASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tesamorelin acetate
CAS:Tesamorelin acetate is a synthetic peptide that functions as a growth hormone-releasing hormone (GHRH) analog. It is derived through complex chemical synthesis techniques that mimic the natural GHRH sequences found in the human body. The mode of action of Tesamorelin involves binding to GHRH receptors in the pituitary gland, which stimulates the secretion of growth hormone. This increase in growth hormone levels subsequently enhances insulin-like growth factor-1 (IGF-1) production, leading to various metabolic effects.Tesamorelin acetate is primarily utilized in the medical field for the reduction of excess visceral adipose tissue in patients with HIV-associated lipodystrophy. This condition leads to the abnormal distribution of body fat, posing significant health risks. By modulating the growth hormone axis, Tesamorelin helps in decreasing visceral fat accumulation, thereby improving body composition and metabolic health in affected individuals. It is important to note that the use of Tesamorelin should be carefully monitored within clinical settings to assess efficacy and safety.
Fórmula:C221H366N72O67SPureza:Min. 98 Area-%Cor e Forma:PowderMyosin H Chain Fragment, mouse
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C91H149N25O28SPeso molecular:2,073.37 g/molHXB2 gag NO-83/aa329 - 343
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,514.9 g/molFS1 peptide
FS1, a synthetic BH3 peptide used in BH3 profiling, shows promise in enhancing Natural Killer (NK) cell-mediated cancer therapy. By selectively targeting anti-apoptotic BCL-2 family proteins, FS1 can trigger cytochrome c release in sensitive cancer cell lines, promoting apoptosis. This mechanism synergizes with NK cell activity, leading to increased cancer cell death both in vitro and in vivo. Therefore, FS1 represents a potential therapeutic agent for enhancing NK cell-based immunotherapy approaches.
H-Ser-His-OH acetate
CAS:H-Ser-His-OH acetate salt is an amide that has been shown to have a neutral pH and to be soluble in organic solvents such as chloroform. It has a biological function of being a serine protease inhibitor. H-Ser-His-OH acetate salt binds to the amino acid histidine and inhibits the activity of serine proteases. This product has been used in fluorescence techniques, immunofluorescence analyses, and molecular biology.Fórmula:C9H14N4O4·xC2H4O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:242.24 g/molH-SSVSDYVNYDIIVR^-OH
Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gonadoliberin-2 (Human, Chicken)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,236.33 g/molMca-Pro-Leu-OH
CAS:Mca-Pro-Leu-OH is a monoclonal antibody that recognizes the antigen staphylococcus. It is useful for the diagnosis of postoperative infections, nephrology dialysis, and in renal transplantation to prevent graft rejection. It has been used as an immunofluorescent stain in human chorionic gonadotropin (hCG) and follicle stimulating hormone (FSH) studies. Mca-Pro-Leu-OH is a mouse monoclonal antibody that reacts with human chorionic gonadotropin (hCG). The specificity of this antibody has been shown to be very high since it does not react with other proteins found in nature such as follicle stimulating hormone (FSH).Fórmula:C23H28N2O7Pureza:Min. 95%Cor e Forma:PowderPeso molecular:444.48 g/molH-TYLPAVDEK^-OH
Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGFLHSGTAK^-OH
Peptide H-LGFLHSGTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^LITGRLQSL-OH
Peptide H-R^LITGRLQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C45H82N12O12S1Peso molecular:1,015.27 g/molAc-CEKEEDERVQGGDREPLLQEE-OH
Peptide Ac-CEKEEDERVQGGDREPLLQEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phosphorylated Protein Kinase C Substrate 2
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C34H69N16O11PPeso molecular:909.02 g/mol1,3-Dipalmitoylglycerol
CAS:1,3-Dipalmitoylglycerol is a diacylglycerol, which is a type of fatty acid that is also known as a 1,2-diacylglycerol. It has been shown to exhibit hemolytic activity in the presence of hydroxyl groups. The optimum pH for 1,3-dipalmitoylglycerol is at around 7.5 and it can be used as a biocompatible polymer to form controlled-release preparations with neutral pH that are tumoricidal.Fórmula:C35H68O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:568.91 g/molZ-Ile-Ser-OH
CAS:Z-Ile-Ser-OH is a fine chemical that belongs to the group of useful scaffolds and versatile building blocks. It is a useful intermediate in research and as a reaction component in speciality chemicals. Z-Ile-Ser-OH has been shown to be an excellent reagent for complex compounds. This compound is used as a building block for pharmaceuticals, agrochemicals, and other chemicals. Z-Ile-Ser-OH has high quality and can be used as a research chemical or as an intermediate for other chemical syntheses.Fórmula:C17H24N2O6Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:352.38 g/mol1,2-Dimyristoyl-rac-glycerol
CAS:1,2-Dimyristoyl-rac-glycerol (1,2-DMG) is a monomolecular fatty acid that has been found to inhibit the replication of herpes simplex virus. It binds to the surface glycoprotein and inhibits the release of diacylglycerol from the lipid membrane. 1,2-DMG also inhibits the activity of acyl chain enzymes, which are necessary for the synthesis of fatty acids in trypanosomes. This inhibition prevents the growth and proliferation of lung fibroblasts and may be beneficial in treating cancer. The ionisation mass spectrum shows that 1,2-DMG has a molecular weight of 270 Da. The binding affinity between 1,2-DMG and water is 9 x 10 M at room temperature.Fórmula:C31H60O5Pureza:Min. 90%Cor e Forma:White PowderPeso molecular:512.81 g/molrec FGF acidic (human)
CAS:Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-GLSPTVWLSV^-OH
Peptide H-GLSPTVWLSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-Asp-OH
CAS:H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.Fórmula:C7H12N2O5Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molH-TVAAPSVFIFPPSDEQL^K-OH
Peptide H-TVAAPSVFIFPPSDEQL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C73H116N20O18Peso molecular:1,561.84 g/molLMP2 (340-350), SSC
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,111.3 g/molH-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDVTAQIALQPALK^-OH
Peptide H-GDVTAQIALQPALK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-Substance P
Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons, astrocytes, microglia, epithelial cells, endothelial cells, immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.Biotin (B7) has been added to the N-terminus.Fórmula:C73H112N20O15S2Peso molecular:1,573.96 g/molAc-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239-1
Peptide SIVmac239-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C65H115N21O23S1Peso molecular:1,590.83 g/molvitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C54H95N17O17Peso molecular:1,254.44 g/molH-GNDVAFHFNPR^-OH
Peptide H-GNDVAFHFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,688 g/molH-VAELEHGSSAYSPPDAFK^-OH
Peptide H-VAELEHGSSAYSPPDAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CEPLEKQHEKERKQEEGES
Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-Asp(Lys-OH)-OH
CAS:H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).Fórmula:C10H19N3O5Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:261.28 g/molAc-DEVDAFC-OH
Peptide Ac-DEVDAFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YVRPGGGFVPNFQLFEK^-OH
Peptide H-YVRPGGGFVPNFQLFEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAGIGILTV^-OH
Peptide H-AAGIGILTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bid BH3-r8 TFA
Catalogue peptide; min. 95% purityFórmula:C145H260N66O41S•(C2HF3O2)xPeso molecular:3,616.17 g/mol
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50797.webp&w=3840&q=75)
