Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29793 produtos de "Peptídeos"
H-GVFELSDEK^-OH
Peptide H-GVFELSDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVWMSWVR^-OH
Peptide H-DVWMSWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAPVNISSSDLTGR^-OH
Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CONSENSUS B Tat - 02
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,772 g/molSIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,618.8 g/molH-NNHTASILDR^-OH
Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QIMYNYPAM-OH
Peptide Ac-QIMYNYPAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RDGY-NH2
Peptide Ac-RDGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PKC β pseudosubstrate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C177H294N62O38S3Peso molecular:3,994.84 g/molH-HLEINPDHSIIETLR^-OH
Peptide H-HLEINPDHSIIETLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQVSLTCLVK^-OH
Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,093.3 g/molH-LCL-OH
H-LCL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,632.8 g/molH-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEVQVTVPK^-OH
Peptide H-FEVQVTVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFLEPIGADIALLK^-OH
Peptide H-LFLEPIGADIALLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HCV NS4A 1635-1643 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLCBiot-VTSAPDTRPAPGSTAPPAHG-OH
Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C186H275N51O59Peso molecular:4,169.54 g/molH-VVVGAGGVGK^-OH
Peptide H-VVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.9 g/molH-SPALHFLGGGSC-NH2
Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,771 g/molH-NIYLNSGLTSTK^-OH
Peptide H-NIYLNSGLTSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HCMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
SIVmac239 - 23
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,777 g/molAF488 NHS Ester
CAS:Please enquire for more information about AF488 NHS Ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C25H17N3O13S2Pureza:Min. 95%Peso molecular:631.5 g/molNBD peptide / NF-κB blocker (cell permeable)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C121H202N48O32Peso molecular:2,841.2 g/molH-ELINNELSHFLEEIK^-OH
Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDGCYCDSLENLADGYK^-OH
Peptide H-FDGCYCDSLENLADGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTEQGAELSNEER^-OH
Peptide H-AVTEQGAELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RADARADARADARADA-NH2
Peptide Ac-RADARADARADARADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGEEEEYFELVKKKK-OH
CAS:JAK3tide is a synthetic peptide, which is a highly specific substrate. Derived from comprehensive biochemical studies, it targets the catalytic activity of the Janus kinase 3 (JAK3) enzyme. JAK3tide's mode of action involves being phosphorylated by JAK3, an essential kinase involved in the signaling pathways of certain cytokines, making it a vital tool for assaying JAK3 activity.When used in in vitro kinase assays, it enables precise quantification of JAK3's enzymatic activity, which is pivotal for understanding pathway dynamics involved in immune responses. Its application extends to research areas focused on elucidating the mechanisms of immune signaling pathways and for the development of inhibitors as potential therapeutic agents in immunological disorders. JAK3tide provides a robust framework for scientists aiming to dissect the nuanced interactions within the JAK-STAT pathway and identify novel therapeutic targets, particularly in conditions where JAK3 is dysregulated.Fórmula:C82H129N19O27Peso molecular:1,813.02 g/molH-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is used as building blocks in the synthesis of peptide derivatives, such as amines, alcohols, thiols, and other amino acids. This resin has been shown to be stable in aqueous or organic solvents.
Pureza:Min. 95%H-GDYDLNAVR^-OH
Peptide H-GDYDLNAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGAVYSSDEAL^IPIR-OH
Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-90
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,597.9 g/molH-V^LSGEDKSNIK-OH
Peptide H-V^LSGEDKSNIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAPATGGVK^-OH
Peptide H-SAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB
2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB is a resin that is used as a building block for peptide synthesis. It can be used to synthesize the building blocks for peptides, including amino acids, alcohols and amines. 2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB has been shown to react with thiols, alcohols and amines in solution to form covalent bonds. It can also be used as a tool in the synthesis of thiols, alcohols or amines.Pureza:Min. 95%δ Sleep Inducing Peptide
Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C35H48N10O15Peso molecular:848.83 g/molBPC 157 trifluoroacetate
CAS:Produto ControladoBody Protecting Compound (BPC) 157 is a pentadecapeptide gut peptide with free radical scavenging activity. As a gastric juice pentadecapeptide fragment, BPC 157 stimulates nitric oxide synthase generation, offering significant gastric cytoprotection. It has been shown to heal lesions in experimental models of bowel disease, Unlike many other peptides, BPC 157 effectively acts without a carrier, notably aiding in muscle healing, such as in the treatment of gastrocnemius muscle complex injuries. BPC 157 is also an anti-inflammatory agent that has been shown to have clinical relevance in patients with congestive heart failure. BPC 157 has been shown to inhibit inflammation by blocking the production of proinflammatory mediators such as prostaglandins and leukotrienes. It also suppresses the production of proinflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β). BPC 157 also downregulates genes that are involved in liver fibrosis, which may account for its efficacy in patients with liver cirrhosis. BPC 157 increases the production of hepatocyte growth factors (HGFs), which stimulate cell proliferation and promote tissue repair. It also upregulates genes involved in wound healing. Additionally, BPC 157 displays antianxiety and antidepressant effects. At the cellular level, it fosters proliferation, migration, and tube formation in human umbilical vein endothelial cells by activating ERK1/2 phosphorylation.
Fórmula:C62H98N16O22•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,419.53 g/molH-NTQPIMDTDGSYFVYSK^-OH
Peptide H-NTQPIMDTDGSYFVYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STALQLIQR^-OH
Peptide H-STALQLIQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Val-Val-Gly-Ala-Asp-Gly-Val-Gly-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C39H69N11O13Peso molecular:900.03 g/molAc-Gly-D-Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-(Gly)4-Ser-D-Arg-(Leu)6-D-Arg-NH2
This synthetic peptide is a hydrophobic RGD Fibronectin Peptide which enhances cell attachment and adhesion. This is due to it containing the Arg-Gly-Asp (RGD) sequence, is a highly conserved integrin recognition sequence within fibronectin. As a result it can promote the adhesion of cells to fibronectin, a protein found in the extracellular matrix and also promotes adhesin of cells to collagen and laminin. One-Letter Formula: Ac-GrGDSPASSKGGGGSrLLLLLLr-AmideFórmula:C98H174N34O30Pureza:Min. 95%Peso molecular:2,308.69 g/molVal-Ile-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C20H31N3O4Peso molecular:377.48 g/molLCBiot-STHTLDLSR-OH
Peptide LCBiot-STHTLDLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5TAMRA-RRRRRRRRRC-NH2
Peptide 5TAMRA-RRRRRRRRRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENAGEDPGLAR^-OH
Peptide H-ENAGEDPGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGLKPEQA-NH2
Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 73 (HIMLDVAFTSHEHFG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,741 g/molAc-SRT-NH2
Peptide Ac-SRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Leu-Wang Resin (100-200 mesh) 1% DVB
Fmoc-D-Leu-Wang Resin (100-200 mesh) is a research tool that is an activator, ligand, and receptor. It is used in the study of cell biology, antibody production, ion channels, and protein interactions. Fmoc-D-Leu-Wang Resin (100-200 mesh) can be used to make peptides or as a pharmacological inhibitor. This product is high purity and has CAS No.Pureza:Min. 95%Tat-NR2Bct
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C105H188N42O30Peso molecular:2,518.9 g/molH-ALGHLDLSGNR^-OH
Peptide H-ALGHLDLSGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2
Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFVAPFPEVFGK^-OH
Peptide H-FFVAPFPEVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGLPLEEVTVAEVLAAR^-OH
Peptide H-GGLPLEEVTVAEVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSSVEDIK^-OH
Peptide H-GPSSVEDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPLTFGGGTK^-OH
Peptide H-DLPLTFGGGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 6 (HVLKAVFSRGDTPVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,638.9 g/molLCBiot-WSLGYTG-OH
Peptide LCBiot-WSLGYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (30-59) (Human)
Nesfatin-1 (30-59) is a peptide that is isolated from the brain and has been shown to have the ability to regulate feeding behavior. It is thought to be involved in the regulation of appetite and body weight. Nesfatin-1 (30-59) has been shown to inhibit ghrelin secretion, which is a hormone involved in hunger and satiety. This peptide also appears to stimulate insulin secretion by pancreatic beta cells, which may contribute to its anti-diabetic effects.
Fórmula:C167H263N41O54Pureza:Min. 95%Peso molecular:3,709.2 g/molH-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TATSEYQTFFNPR^-OH
Peptide H-TATSEYQTFFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SNKDRHIDSSC-NH2
Peptide Ac-SNKDRHIDSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Palmitoyl pentapeptide 4 acetate
CAS:Palmitoyl pentapeptide 4 acetate is a medicinal compound that has been shown to have anticancer properties. It works by inducing apoptosis, or programmed cell death, in cancer cells. This compound has been used in traditional Chinese medicine to treat various types of tumors. Palmitoyl pentapeptide 4 acetate acts as an inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. It has been shown to be effective against multiple types of cancer cells, including those found in the urine. This compound is an analog of a natural protein kinase inhibitor and is often used in combination with other inhibitors for maximum effect.Fórmula:C39H75N7O10•(C2H4O2)xPureza:Min. 95%Cor e Forma:PowderH-SNL-NH2
Peptide H-SNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLNQFDDAGIVTR^-OH
Peptide H-VLNQFDDAGIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RDVYEEDSYVKRSQG-NH2
Peptide Biot-RDVYEEDSYVKRSQG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 2 (GRRCPEMISVLGPIS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,615 g/molH-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-93
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,698 g/molEGFRvIII peptide (PEPvIII)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C70H111N19O24SPeso molecular:1,634.81 g/molHXB2 gag NO-18
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,667.8 g/molCMVpp65 - 100 (DDVWTSGSDSDEELV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,653.6 g/molH-GNPTVEVDLFTSK^-OH
Peptide H-GNPTVEVDLFTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPPGF^-OH
Peptide H-RPPGF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Indolicidin
Peptide Indolicidin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C100H132N26O13Peso molecular:1,906.33 g/molVIP Antagonist
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C154H257N49O40SPeso molecular:3,467.13 g/molH-AQAASLEAEHQAIIR^-OH
Peptide H-AQAASLEAEHQAIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,694.1 g/molH-FSGVPDR^-OH
Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Exendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C184H282N50O60SPeso molecular:4,186.63 g/molHXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HHHHHH-OH
Peptide Ac-HHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 47 (AFVFPTKDVALRHVV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,699 g/molAoa-SMFVYGGCQGNNNNFQSKANC-NH2
Peptide Aoa-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Asn670,Sta671,Va672)-Amyloid β/A4 Protein Precursor770 (662-675) ammonium salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H118N16O27Peso molecular:1,651.83 g/molH-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,800.1 g/molH-SILKV-NH2
Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RASTIEMPQQAR^-OH
Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QDVDNASLAR^-OH
Peptide H-QDVDNASLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-His(Trt)-Rink-Amide MBHA Resin
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.
Pureza:Min. 95%SIVmac239 - 19
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,785.1 g/molH-GAL^^QNIIPASTGAAK-OH
Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
proFIX18
Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C95H157N31O27Peso molecular:2,165.5 g/molSOR-C13
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C72H116N20O19Peso molecular:1,565.81 g/molH-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2
H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 is a tetrameric peptide that has been shown to have a broad spectrum of biological activity. This peptide may be involved in the regulation of cell growth and proliferation, which may contribute to its anti-inflammatory effects. H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 also inhibits the production of nitric oxide, which may contribute to its antimicrobial properties against bacteria and fungi.Fórmula:C123H179N39O34Pureza:Min. 95%Peso molecular:2,748.04 g/molBiot-KKKKEEIYFFF-OH
Peptide Biot-KKKKEEIYFFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HCV NS5B 2588-2596 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.H-VTSIQD^WV^Q^K^-OH
Peptide H-VTSIQD^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MBP (1-11), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C52H88N22O17Peso molecular:1,293.42 g/molH-FSPDDSAGASA^LLR-OH
Peptide H-FSPDDSAGASA^LLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ranatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H85N16O13SPeso molecular:1,281.5 g/molCMVpp65 - 125 (VPMVATVQGQNLKYQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,676 g/molHXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,663.8 g/molH-Glu(Leu-OH)-OH
CAS:H-Glu(Leu-OH)-OH is a postprandial plasma metabolite that is produced by the hydrolysis of proteins and peptides. The profile of H-Glu(Leu-OH)-OH in plasma can be used to characterize the metabolism of these compounds and has been found to be useful for the diagnosis of metabolic disorders. H-Glu(Leu-OH)-OH levels are increased in patients with metabolic syndrome, obesity, diabetes mellitus type 2, chronic kidney disease, and cancer. This metabolite can also be used as an indicator for bacterial enzyme activity in the gut. H-Glu(Leu-OH)-OH levels are correlated with glutamate and sodium hydroxide solution levels in plasma or urine samples. H-Glu(Leu-OH)-OH may play a role in the pathogenesis of cancer due to its ability to inhibit DNA synthesis and protein synthesis.Fórmula:C11H20N2O5Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:260.29 g/molCMVpp65 - 58 (ESFCEDVPSGKLFMH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,726 g/molH-YGIENVK^-OH
Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-HWSY(dW)L^RP-NHEt
pE-HWSY(dW)L^RP-NHEt is a catalog research peptide that is held in stock. pE-HWSY(dW)L^RP-NHEt is provided at >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer pE-HWSY(dW)L^RP-NHEt in bulk quantities in addition to our standard pack sizes.Please enquire for more information about pE-HWSY(dW)L^RP-NHEt at the technical inquiry form on this page
Pureza:Min. 95%H-ALPNNTSSSPQPK^-OH
Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MASMTGGQQMGR^-OH
Peptide H-MASMTGGQQMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGEYGFQNAL^-OH
Peptide H-LGEYGFQNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-MSGRPRTTSFAES-NH2
Peptide Biot-MSGRPRTTSFAES-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APGLTQALNTK^-OH
Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Suc-Ala-Ala-Ala-AMC
CAS:Suc-Ala-Ala-Ala-AMC is a fluorogenic substrate that can be used to measure the activity of serine proteases. Suc-Ala-Ala-Ala-AMC has been shown to have high values in mammalian tissue. It also has high activity against many bacteria and fungi, as well as proteolytic enzymes such as collagenase and matrix metalloproteinase. This substrate is activated by phorbol esters and has an optimum pH of 5.5. Suc-Ala-Ala-Ala AMC is a model protein for determining the antibacterial efficacy of various antibiotics.Fórmula:C23H28N4O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:488.49 g/molGly-Val-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C12H23N3O4Peso molecular:273.33 g/molH-ASDPSLK^-OH
Peptide H-ASDPSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALAENNLNLPK^-OH
Peptide H-EALAENNLNLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Bradykinin (1-7)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C35H52N10O9Peso molecular:756.87 g/molAc-CSEGEKARKNIVLARRRP-NH2
Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHGQDYLVGNK^-OH
Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEAGPQGPR^-OH
Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLYTDDAQQTEAHLEIR^-OH
Peptide H-YLYTDDAQQTEAHLEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGFFYTPK^T-OH
Peptide H-RGFFYTPK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVY^DGEEHSV-OH
Peptide H-GVY^DGEEHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATLTVDK^-OH
Peptide H-ATLTVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVPI-NH2
Peptide H-AVPI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLKEKGGL^-OH
Peptide H-FLKEKGGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-PPAHGVTSAPDTRPA-OH
Peptide LCBiot-PPAHGVTSAPDTRPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVCVLK^-OH
Peptide H-AVCVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA leader peptide LVL (heavy-labeled)
Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack.Peptide H-VMAPRTLL^-OH is a heavy-labeled version of PP45242, and is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2
Peptide H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDNPNLPR^-OH
Peptide H-DDNPNLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Tyr-Arg-Leu-Leu-Ser-Phe-NH2
H-Tyr-Arg-Leu-Leu-Ser-Phe-NH2 is a peptide that is used as a research tool for studying the role of PAR receptors in the regulation of vascular tone. It also has been shown to have an effect on blood pressure, which may be due to its ability to activate PAR2 receptors.
Fórmula:C39H60N10O8Pureza:Min. 95%Peso molecular:796.46 g/molAc-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPLSLPVGPR^-OH
Peptide H-LPLSLPVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQEEIDHVIGR^-OH
Peptide H-VQEEIDHVIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILIDTSR^-OH
Peptide H-GILIDTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KITDFGRAK^-OH
Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQGTFTSDYSK^-OH
Peptide H-HSQGTFTSDYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSLPSLDPASAK^-OH
Peptide H-SVSLPSLDPASAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDGPVK^V-OH
Peptide H-SDGPVK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 24
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,919.2 g/molH-Val-Trp-OH
CAS:H-Val-Trp-OH is a noncompetitive inhibitor of the enzyme tyrosinase, which plays a role in melanin production. It also has radical scavenging activities and can inhibit the activity of other enzymes such as glucose 6-phosphate dehydrogenase and acetylcholinesterase. The compound is stable in aqueous solution and can be used to study the effects of H-Val-Trp-OH on wheat germ cells. It is composed of an amino acid sequence that resembles tyrosine, with a carboxylate group attached to the hydroxyl group at position 3. H-Val-Trp-OH is most active against tyrosinase when it is in its activated form, but it can also act as an inhibitor when it is not activated. The compound inhibits the activity of tyrosinase by binding to its active site and blocking the binding or catalysis of substrate molecules. This inhibition occurs through competitive interactions withFórmula:C16H21N3O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:303.36 g/molH-DPLAVDK^-OH
Peptide H-DPLAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLPSDFFP^SV^-OH
Peptide H-FLPSDFFP^SV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Orn-AMC hydrochloride salt
CAS:H-Orn-AMC hydrochloride salt is a white solid with a melting point of about 150°C. It is used as a reactant in the manufacture of pharmaceuticals, research chemicals and other speciality chemicals. H-Orn-AMC hydrochloride salt is also an intermediate for the synthesis of complex compounds, useful as building blocks for chemical synthesis, and can be used as a reagent in analytical chemistry.Fórmula:C15H20ClN3O3Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:325.79 g/molH-DLPSPIER^-OH
Peptide H-DLPSPIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFGPVDSEQLSR^-OH
Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.IDE Inhibitor 6bK
The enzyme inhibitor 6bK is a peptide that inhibits the activity of insulin. It has been shown to inhibit the synthesis of protein, DNA, and RNA in cells. This inhibition has led to cell death by apoptosis. 6bK has also been shown to have anti-inflammatory effects.
Fórmula:C41H55N7O7Pureza:Min. 95%Peso molecular:757.94 g/molAc-LLVP-NH2
Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Asp-pNA
CAS:Ac-Asp-pNA is a carboxy, serine protease that is used as an antigen in bactericidal and antibacterial assays. It also has been shown to be effective against neutral ph organisms such as E. coli and Pseudomonas aeruginosa. Ac-Asp-pNA elutes from the column when it is inactivated under neutral ph conditions, which can be seen by the presence of reactive peaks. The protonation of Ac-Asp-pNA at high pH results in a loss of reactivity, which can be detected by the diminazene peak at low pH. This protein is activated by potassium ions and cellular proteins, which can be seen by the presence of peaks at m/z 816 and 806 respectively.Fórmula:C12H13N3O6Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:295.25 g/molZ-Gly-Pro-AMC
CAS:Z-Gly-Pro-AMC is a substrate molecule that mimics the natural substrate of dipeptidyl peptidase IV (DPP-IV) and is used in the study of plant physiology. It has been shown to inhibit DPP-IV activity by binding to the enzyme’s active site, preventing it from cleaving biologically active peptides. This drug also has an antidiabetic effect, which may be due to its ability to inhibit α-amylase activity. Z-Gly-Pro-AMC also has been shown to increase locomotor activity and reduce body weight in rats with metabolic disorders. Z-Gly-Pro-AMC inhibits serine proteases, such as trypsin, chymotrypsin, elastase, and cathepsin G, which are involved in tumor progression.
Fórmula:C25H25N3O6Pureza:Min. 98%Cor e Forma:White PowderPeso molecular:463.48 g/molH-VVLPISIYAK^-OH
Peptide H-VVLPISIYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Cys(Dpm)-OH
CAS:Fmoc-Cys(Dpm)-OH is a chemical that belongs to the group of reaction components. It is a high quality reagent for research and development and can be used as a building block in the synthesis of other fine chemicals. Fmoc-Cys(Dpm)-OH is also an intermediate for the synthesis of complex compounds such as peptides, proteins, and antibiotics. This compound has a broad range of applications in biomedicine, organic chemistry, and pharmaceuticals.
Fórmula:C31H27NO4SPureza:Min. 95%Cor e Forma:White SolidPeso molecular:509.62 g/molAc-Ala-Ser-Thr-Asp-AMC
CAS:Ac-Ala-Ser-Thr-Asp-AMC is a versatile building block that can be used as an intermediate in organic synthesis, a reagent, or a speciality chemical. It is also a useful scaffold for drug discovery and development. Ac-Ala-Ser-Thr-Asp-AMC has been shown to be an effective inhibitor of phosphodiesterase 3 (PDE3) and cyclic nucleotide phosphodiesterases (PDEs).Fórmula:C26H33N5O11Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:591.57 g/molMca-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH trifluoroacetate
CAS:Please enquire for more information about Mca-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C53H64N10O19•(C2HF3O2)xPureza:95%NmrCor e Forma:PowderPeso molecular:1,145.13 g/molH-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu-Thr-OH
CAS:H-Glu-Thr-OH is a molecule that belongs to the group of aminoglycosides. It is a broad spectrum antibiotic that inhibits bacterial protein synthesis by binding to the 30S ribosomal subunit. H-Glu-Thr-OH has been shown to be effective against various bacteria, including those that are resistant to other antibiotics such as penicillin and erythromycin. This drug has also been shown to be effective against cancer cells in vitro. H-Glu-Thr-OH is a potent inhibitor of inflammatory bowel disease, which may be due to its ability to inhibit the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα). The drug also has an insulin sensitizing effect in type 2 diabetes mellitus patients, which may be due to its ability to enhance glucose uptake into skeletal muscle cells and adipocytes.
Fórmula:C9H16N2O6Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:248.23 g/molCMVpp65 - 131 (YRIFAELEGVWQPAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,750 g/molAc-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin Basic Protein (83-99) (bovine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C93H143N25O24Peso molecular:1,995.31 g/mol(Des-Glu22)-Amyloid β-Protein (1-42) trifluoroacetate
CAS:The E22delta (Osaka mutation) mutation of Amyloid β promotes β-sheet transformation.Fórmula:C198H304N54O57SPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:4,384.93 g/molAc-ADE-OH
Peptide Ac-ADE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YYGYTGAFR^-OH
Peptide H-YYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSISWAR^-OH
Peptide H-FSISWAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Motilin (human, porcine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C120H188N34O35SPeso molecular:2,699.1 g/molp53 Protein, human, recombinant
The p53 protein is a transcription factor that regulates the cell cycle and suppresses tumor development. It is a type of tumor suppressor protein that helps prevent cells from becoming cancerous. The p53 protein is found in every human cell and has been shown to play an important role in apoptosis, or programmed cell death. The recombinant p53 protein can be used as an inhibitor for ion channels and as a research tool for studying protein interactions.Pureza:Purified By Proprietary Chromatographic TechniquesH-GISVHISNAEPK^-OH
Peptide H-GISVHISNAEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Prostatic acid phosphatase (112-120)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
(Des-Gly10,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:Please enquire for more information about (Des-Gly10,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C59H84N16O12•(C2HF3O2)xPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:1,209.4 g/molH-Arg-Gly-Asp-Ser-Lys-OH
H-Arg-Gly-Asp-Ser-Lys-OH is a peptide that is used as a marker for the identification of villi in the small intestine. The peptide is synthesized by gland cells in the intestinal epithelium and released into the lumen of the small intestine. It is then taken up by other cells such as enterocytes, which are located at the apical end of villi. In untreated animals and humans, H-Arg-Gly-Asp-Ser-Lys-OH can be detected using immunohistochemistry on tissue sections and flow cytometry.Fórmula:C21H39N9O9Pureza:Min. 95%Peso molecular:561.6 g/molFMRF-like neuropeptide flp-9-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H66N12O8Peso molecular:879 g/molMet-Enkephalin-Arg-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C42H56N10O9SPeso molecular:877.04 g/molS-Methyl-L-thiocitrulline acetate salt
CAS:Produto ControladoS-Methyl-L-thiocitrulline acetate salt (SMTSA) is an inhibitor of the enzyme cyclase that inhibits the production of 5-hydroxytryptamine (5-HT) in the gastrointestinal tract. SMTSA has been shown to reduce 5-HT concentrations in mesenteric vessels and inhibit the physiological effects of 5-HT in rats. This drug also inhibits dopamine release from synaptosomes, which may be due to its ability to act as a competitive inhibitor of ester hydrochloride, dinucleotide phosphate, and cyclase. In addition, this drug has been shown to have a cytotoxic effect on cardiac myocytes by causing calcium influx into the cytosol and inhibiting ryanodine receptor channels.Fórmula:C7H15N3O2SPureza:Min. 95%Cor e Forma:PowderPeso molecular:205.28 g/molHXB2 gag #58
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,560.7 g/molAc-KLTWQELYQLK^YKGI-NH2
Peptide Ac-KLTWQELYQLK^YKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YV^GGQEHFAHLLILR^-OH
Peptide H-YV^GGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Met-Ala-Ser-OH
CAS:Ac-Met-Ala-Ser-OH is a fine chemical that can be used as a building block in the synthesis of other compounds. It is also a reagent and speciality chemical, which are substances that are not typically found in everyday life but have specific uses. Ac-Met-Ala-Ser-OH is an intermediate chemical, meaning it is used to make something else, and can be used as a scaffold for developing new compounds. Ac-Met-Ala-Ser-OH has CAS number 149151-19-9.
Fórmula:C13H23N3O6SPureza:Min. 95%Cor e Forma:PowderPeso molecular:349.4 g/mol
![H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3975-PI.webp&w=3840&q=75)
