CAS 12279-41-3

Seractide

Description:

Seractide, with the CAS number 12279-41-3, is a chemical compound primarily known for its application in the field of pharmaceuticals and biochemistry. It is a synthetic surfactant that exhibits properties such as emulsification, wetting, and dispersing, making it useful in various formulations. Seractide is often utilized in the preparation of drug delivery systems, enhancing the solubility and bioavailability of poorly soluble compounds. Its amphiphilic nature allows it to interact with both hydrophilic and hydrophobic substances, facilitating the stabilization of emulsions and suspensions. Additionally, Seractide may possess biological activity, contributing to its role in enhancing the efficacy of therapeutic agents. Safety and handling precautions are essential when working with this compound, as with many surfactants, due to potential irritant properties. Overall, Seractide serves as a valuable tool in pharmaceutical formulations and research, contributing to advancements in drug delivery technologies.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S₁

Synonyms:

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS: 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purity: 99.2%

Color and Shape: White

Molecular weight: 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS: 12279-41-3

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purity: 98%

Color and Shape: Solid

Molecular weight: 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS: 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purity: 99.6%

Color and Shape: White Lyophilised Solid

Molecular weight: 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS: 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purity: Min. 98 Area-%

Color and Shape: Powder

Molecular weight: 4,541.07 g/mol

Ref: 3D-FA108368