CAS 130357-25-4

Exendin-3

Description:

Exendin-3 is a peptide that is derived from the saliva of the Gila monster (Heloderma suspectum) and is known for its role as a glucagon-like peptide-1 (GLP-1) receptor agonist. It consists of 39 amino acids and exhibits structural similarities to human GLP-1, which is involved in glucose metabolism and insulin secretion. Exendin-3 has gained attention for its potential therapeutic applications in the treatment of type 2 diabetes and obesity due to its ability to enhance insulin secretion in response to glucose, inhibit glucagon release, and promote satiety. The substance is characterized by its stability and prolonged action compared to native GLP-1, making it a valuable candidate for pharmacological development. Additionally, Exendin-3 has been studied for its neuroprotective effects and potential applications in neurodegenerative diseases. Its CAS number, 130357-25-4, is a unique identifier that facilitates the identification and study of this specific chemical compound in scientific literature and regulatory contexts.

Formula: C₁₈₄H₂₈₂N₅₀O₆₁S

Synonyms:

• H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 >=97%
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• EXENDIN-3
• M.W. 4202.57 C184H282N50O61S
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN-3 USP/EP/BP
• HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Exendin-3

CAS: 130357-25-4

Exendin-3, a member of the glucagon superfamily, was originally isolated from the venom of the lizard, Heloderma horridum. At low concentrations, the 39-amino acid peptide interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, whereas at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release.

Formula: C₁₈₄H₂₈₂N₅₀O₆₁S

Purity: 98.6%

Molecular weight: 4202.63

Ref: 01-4015051

Exendin-3

CAS: 130357-25-4

Exendin-3, a peptide from Gila monster venom, stimulates pancreatic secretion and belongs to the glucagon family.

Formula: C₁₈₄H₂₈₂N₅₀O₆₁S

Purity: 98%

Color and Shape: Solid

Molecular weight: 4202.57

Ref: TM-TP1768

Exendin-3

CAS: 130357-25-4

Formula: C₁₈₄H₂₈₂N₅₀O₆₁S

Molecular weight: 4202.56

Ref: 7W-GK4553

Exendin-3

CAS: 130357-25-4

Please enquire for more information about Exendin-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Formula: C₁₈₄H₂₈₂N₅₀O₆₁S

Purity: Min. 95%

Molecular weight: 4,202.57 g/mol

Ref: 3D-FE110340