CAS 133514-43-9

exendin fragment 9-39

Description:

Exendin fragment 9-39 is a peptide derived from the exendin-4 molecule, which is a glucagon-like peptide-1 (GLP-1) analog. This specific fragment is known for its role as a competitive antagonist of the GLP-1 receptor, which is significant in the regulation of glucose metabolism and insulin secretion. The peptide consists of 31 amino acids and is characterized by its ability to inhibit the actions of GLP-1, making it a subject of interest in diabetes research and potential therapeutic applications. Its structure includes a sequence that allows it to bind to the GLP-1 receptor, but unlike GLP-1, it does not activate the receptor, thus blocking its effects. The CAS number 133514-43-9 uniquely identifies this compound in chemical databases, facilitating its study and application in pharmacological contexts. Overall, exendin fragment 9-39 serves as a valuable tool in understanding GLP-1 receptor signaling and its implications in metabolic disorders.

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Synonyms:

• Exendin (9-39)
• Exendin(9-39)amide
• Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
• H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 (9-39) amide USP/EP/BP
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
• Exendin Fragment 9-39 >=95% (HPLC)
• 9-39-Exendin 3(Heloderma horridum) (9CI)
• EXENDIN-3 (9-39) AMIDE
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• 9-39-Exendin 3(Heloderma horridum)
• DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
• Exendin 4 (9-39) amide
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• M.W. 3369.79 C149H234N40O47S
• Exendin FragMent 9-39Exendin
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN [9-39] PEPTIDE
• EXENDIN FRAGMENT 9-39
• EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
• Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
• Exendin (9-39) Acetate

Exendin (9-39)

CAS: 133514-43-9

For cellular and molecular biology applications

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Molecular weight: 3369.75

Ref: 02-J66126

Exendin (9-39)

CAS: 133514-43-9

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Purity: 97.4%

Color and Shape: White Powder

Molecular weight: 3369.8

Ref: 01-4017799

Exendin (9-39)

CAS: 133514-43-9

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Purity: 99%

Color and Shape: Solid

Molecular weight: 3369.7571

Ref: IN-DA00ILPD

Exendin Fragment 9-39

CAS: 133514-43-9

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Purity: ≥ 95.0%

Color and Shape: White powder

Molecular weight: 3369.75

Ref: 7W-GK0935

Avexitide

CAS: 133514-43-9

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Purity: 98% - 99.65%

Color and Shape: Solid

Molecular weight: 3369.76

Ref: TM-TP2100

Exendin (9-39)

CAS: 133514-43-9

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Molecular weight: 3,369.79 g/mol

Ref: 3D-PP50554

Exendin (9-39) acetate

CAS: 133514-43-9

Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.

Formula: C₁₄₉H₂₃₄N₄₀O₄₇S

Purity: Min. 95%

Molecular weight: 3,369.76 g/mol

Ref: 3D-FE110341