
CAS 134709-16-3
:MELANOSTATIN (FROG)
Description:
Melanostatin, also known as frog melanostatin, is a peptide that plays a significant role in the regulation of skin pigmentation in amphibians, particularly frogs. It is a naturally occurring substance that functions as a melanocyte-inhibiting factor, influencing the activity of melanocytes, the cells responsible for producing melanin, which gives color to the skin. The peptide is characterized by its specific amino acid sequence, which is crucial for its biological activity. Melanostatin is known to interact with various receptors and signaling pathways, affecting processes such as skin color adaptation and camouflage. Its structure typically includes a series of amino acids linked by peptide bonds, and it may exhibit specific conformational features that are essential for its function. Research into melanostatin has implications for understanding pigmentation disorders and could provide insights into potential therapeutic applications in dermatology and cosmetic science. The CAS number 134709-16-3 uniquely identifies this compound in chemical databases, facilitating its study and application in scientific research.
Formula:C189H285N53S
Synonyms:- MELANOSTATIN (FROG)
- MELANOTROPIN-RELEASE-INHIBITING FACTOR (FROG)
- TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-LYS-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2
- YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2
Sort by
The purity filter is not visible because current products do not have associated purity data for filtering.
Found 1 products.
Melanostatin, frog
CAS:<p>Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].</p>Formula:C189H285N53O57SColor and Shape:SolidMolecular weight:4243.67

