
CAS 159002-68-3
:GLUCAGON-37 (HUMAN, MOUSE, RAT)
Description:
Glucagon-37 is a peptide hormone that plays a crucial role in glucose metabolism and is primarily produced by the alpha cells of the pancreas. It is a 37-amino acid polypeptide, which is a member of the glucagon family of hormones. This substance is involved in increasing blood glucose levels by promoting gluconeogenesis and glycogenolysis in the liver. Glucagon-37 is particularly significant in the context of metabolic regulation and is studied for its potential implications in diabetes management. The CAS number 159002-68-3 specifically identifies this peptide, which is relevant for research and pharmaceutical applications. In terms of its biochemical characteristics, glucagon-37 exhibits a high degree of specificity for its receptor, the glucagon receptor, which is a G protein-coupled receptor. This interaction triggers a cascade of intracellular signaling pathways that ultimately lead to the mobilization of energy stores. Understanding glucagon-37's structure and function is essential for developing therapeutic strategies for metabolic disorders.
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Found 3 products.
Oxyntomodulin (human, mouse, rat)
CAS:Oxyntomodulin potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.Formula:C192H295N61O60SPurity:95.3%Color and Shape:White PowderMolecular weight:4449.9Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFormula:C192H295N61O60SPurity:Min. 95%Molecular weight:4,449.93 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C192H295N61O60SPurity:Min. 95%Molecular weight:4,449.84 g/mol

