
CAS 88894-91-1
:growth hormone releasing factor bovine
Description:
Growth Hormone-Releasing Factor (GHRF) from bovine sources, with the CAS number 88894-91-1, is a peptide hormone that plays a crucial role in stimulating the release of growth hormone (GH) from the anterior pituitary gland. This factor is composed of a chain of amino acids, typically exhibiting a structure that includes a specific sequence essential for its biological activity. GHRF is known for its ability to enhance growth, metabolism, and overall physiological functions in animals, particularly in cattle. It operates through specific receptors on pituitary cells, triggering a cascade of intracellular events that lead to GH secretion. The substance is often utilized in research and veterinary medicine to study growth patterns and metabolic processes. Additionally, it may have implications in human medicine, particularly in understanding growth disorders. GHRF is generally administered via injection due to its peptide nature, which limits its effectiveness when taken orally. Its stability and activity can be influenced by factors such as temperature and pH, necessitating careful handling and storage.
Formula:C220H366N72O66S
Synonyms:- GRF (1-44) (bovine)
- H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Found 2 products.
GHRF, bovine
CAS:bGRF(1-44)-NH2 is a bovine GH-releasing factor that stimulates GH release and synergizes with Hydrocortisone.Formula:C220H366N72O66SColor and Shape:SolidMolecular weight:5104.72GRF (bovine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/mol


