CAS 90880-35-6

neuropeptide Y human

Description:

Neuropeptide Y (NPY) is a 36-amino acid peptide that plays a crucial role in various physiological processes, including appetite regulation, circadian rhythms, and stress response. It is primarily produced in the central nervous system and is involved in neurotransmission. The human form of neuropeptide Y, identified by the CAS number 90880-35-6, exhibits a high degree of conservation across species, indicating its fundamental biological importance. NPY functions by binding to specific receptors, primarily Y1 and Y2 receptors, which are G-protein coupled receptors. This binding can influence a range of cellular responses, including the modulation of neurotransmitter release and the regulation of energy balance. Additionally, NPY is implicated in various pathological conditions, such as obesity, anxiety, and depression, making it a target for therapeutic research. Its stability and bioactivity are influenced by factors such as post-translational modifications and the presence of specific receptor subtypes, highlighting its complexity as a signaling molecule in the nervous system.

Formula: C₁₈₉H₂₈₄N₅₅O₅₇RS

Synonyms:

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
• hnpy
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• Neuropeptide Y (29-64), amide, human
• Neuropeptide Y (huMan, rat)
• hNPY, NPY
• Neuropeptide Y (Alligator mississippiensis)
• Neuropeptide Y (human, rat) Acetate
• NEUROPEPTIDE Y (HUMAN, RAT)
• Human neuropeptide Y (29-64)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• M.W. 4271.68 C189H285N55O57S
• Neuropeptide Y (rat)
• NPY (HUMAN, RAT)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• Neuropeptide Y (Gopherus agassizii)
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• Neuropeptide Y (human pheochromocytoma)
• NPY (huMan, rat)
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
• Neuropeptide Y(1-36)

Neuropeptide Y, Human

CAS: 90880-35-6

For cellular and molecular biology applications

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Molecular weight: 4271.74

Ref: 02-J66797

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Bachem ID: 4012616.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: 95.2%

Color and Shape: White

Molecular weight: 4271.74

Ref: 01-4012616

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Formula: C₆₅H₁₄₂N₂₆O₃

Purity: 98%

Molecular weight: 1335.9954

Ref: IN-DA00GRZM

Neuropeptide Y (human)

CAS: 90880-35-6

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: 98%

Color and Shape: Solid

Molecular weight: 4271.68

Ref: TM-TP1140

Neuropeptide Y

CAS: 90880-35-6

Neuropeptide Y

Ref: 54-BIBA1035

NPY (Human, Rat)

CAS: 90880-35-6

NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: Min. 95%

Molecular weight: 4,271.7 g/mol

Ref: 3D-PNP-4158-S

Neuropeptide Y, human

CAS: 90880-35-6

Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: Min. 95%

Molecular weight: 4,271.69 g/mol

Ref: 3D-FN73521

NPY (Human, Rat)

CAS: 90880-35-6

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: Min. 95%

Molecular weight: 4,271.7 g/mol

Ref: 3D-PNP-4158-V

Neuropeptide Y (human, rat) trifluoroacetate salt

CAS: 90880-35-6

Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Formula: C₁₈₉H₂₈₅N₅₅O₅₇S

Purity: Min. 95%

Molecular weight: 4,271.69 g/mol

Ref: 3D-FN109816