
CAS 94948-82-0
:GRF (1-44) (ovine, caprine)
Description:
GRF (1-44) refers to a synthetic peptide that is a fragment of growth hormone-releasing hormone (GHRH), specifically derived from ovine (sheep) and caprine (goat) sources. This peptide consists of 44 amino acids and plays a crucial role in stimulating the release of growth hormone from the anterior pituitary gland. Its primary characteristics include its ability to enhance growth hormone secretion, which can influence various physiological processes such as growth, metabolism, and tissue repair. GRF (1-44) is often studied in the context of growth hormone regulation and potential therapeutic applications in growth disorders. The CAS number 94948-82-0 uniquely identifies this specific peptide in chemical databases, facilitating its recognition in research and pharmaceutical contexts. As a synthetic compound, GRF (1-44) is typically administered via injection and is subject to regulations regarding its use in research and clinical settings. Its stability, solubility, and biological activity are important factors that researchers consider when investigating its effects and potential applications.
Formula:C221H368N72O66S
Synonyms:- H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2
- Grf (Ovine)
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Found 1 products.
GRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol
