Organic Halides

<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>

<p>Iron trifluoromethanesulfonate is an inorganic compound that is used as a catalyst in organic reactions. It is a salt of iron(III) and triflic acid, with the formula Fe(O)(CF). It has been shown to be a cocatalyst for benzofuran derivatives and can be used to synthesize methyl ketones, alkylation products, diarylmethanes, primary alcohols, and cleavage products. Iron trifluoromethanesulfonate can also be used as a control experiment to study reaction mechanisms.</p>

<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>

<p>2-Ethynyl-5-fluoropyridine is an antagonist drug that is selective for orexin receptors. It has been shown to have a high affinity to the orexin receptor, with a potency that is 10 times higher than the reference compound, benzamide. 2-Ethynyl-5-fluoropyridine has been shown in clinical trials to be effective against narcolepsy and insomnia. This drug also had no adverse effects on cognitive function or psychomotor performance. Research into this compound is ongoing, as it may have potential use in other applications such as Parkinson's disease or Alzheimer's disease.</p>

<p>Trans-4-hydroxy-L-proline methyl ester hydrochloride is a matrix metalloproteinase inhibitor. It inhibits the activity of matrix metalloproteinases, which are enzymes that break down collagen and other proteins in the extracellular matrix. The inhibition of these enzymes leads to a decrease in restenosis, which is the recurrence of artery narrowing after angioplasty or stent placement. Trans-4-hydroxy-L-proline methyl ester hydrochloride has been shown to be effective against chemokine receptors, including CCR5 receptor and chemokines such as TNFα. It also inhibits cytokine production by inhibiting signaling pathways that lead to inflammation and cell proliferation.</p>

<p>2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.</p>

<p>Please enquire for more information about (R)-2-Methylmorpholine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Furaltadone hydrochloride is a drug that belongs to the class of quinolones. It is used as an antibiotic for the treatment of microbial infections and may be used in combination with other antibiotics. Furaltadone hydrochloride binds to bacterial DNA, inhibiting protein synthesis, leading to cell death. The mechanism of action has not been fully elucidated, but it is thought that furaltadone hydrochloride binds to the sodium ion in the hydroxyl group of DNA. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Furaltadone hydrochloride has been shown to have a low systemic effect and high adsorption rate in animals; therefore it may be used as an oral antibiotic or as an injectable drug.</p>

<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>

<p>Please enquire for more information about Hippuryl-Cys(2-aminoethyl)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Chloro-2,4-dimethoxyaniline (5-CDA) is a crystalline solid that belongs to the amine class of chemical compounds. It is used in the production of polyhalogenated anilines and nitrosamines, which are known carcinogens. 5-CDA has been shown to be toxic to animals at high doses and can cause health effects such as irritation of the eyes, skin, and respiratory tract; central nervous system depression; and gastrointestinal disturbances. The toxicity of this compound is related to its ability to form nitrosamines when it comes into contact with nitrite or other N-nitroso compounds. 5-CDA is also present in wastewater effluents from paper mills and agricultural runoff from triticum aestivum fields.</p>

<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>

<p>4-Bromo-2-fluoro-N-methylbenzamide is an impurity in the pharmaceutical drug nilutamide. It is a ligand that binds to the androgen receptor and inhibits the binding of dihydrotestosterone, reducing its effect on prostate cells. 4-Bromo-2-fluoro-N-methylbenzamide has been shown to have pharmacokinetic properties similar to nilutamide, which is a drug used for treating prostate cancer. This impurity is also found in small quantities in other drugs including cyclobutanone, 2-aminoisobutyric acid, and chloral hydrate. The elucidation of these impurities can help regulate the quality of pharmaceutical drugs.</p>

<p>2-[2-Trifluoroethoxyphenoxy]ethyl methanesulfonate is a research chemical that is commonly used in the synthesis of enantioselective compounds. It has been clinically studied for its potential use in the treatment of prostatic hyperplasia, a condition characterized by an enlargement of the prostate gland. This compound has shown promising results in inhibiting the growth of prostatic cells and reducing symptoms associated with hyperplasia. Its enantioselective properties make it an ideal candidate for targeted therapy, allowing for more precise and effective treatment options. Researchers continue to explore the potential applications of 2-[2-Trifluoroethoxyphenoxy]ethyl methanesulfonate in various fields, including medicine and pharmaceuticals.</p>

<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>

<p>6-Chloro-2-hexanone is an organic compound that is a methylcyclopentane with a carbonyl group. It can be synthesized by reacting hexamethylenetetramine, chloral hydrate, and 2-chlorobenzimidazole in the presence of ozone. 6-Chloro-2-hexanone has been used as a reagent for normalizing the content of methyl ketones in oil samples. The reaction products are chloride and 2-chlorobenzaldehyde. 6-Chloro-2-hexanone reacts with fatty acids to produce 3,6,9,12 octadecatrienoic acid. This product also has an analytical method that uses GC and flame ionization detection (FID) to measure the amount of chlorine atoms present in a sample. 6-Chloro-2-hexanone also has biological functions such as regulating the activity of enzymes involved in lipid metabolism and</p>

<p>2-Chlorothiazole is a solvent that is used in the chlorinating of acetylcholine. It has been shown to be carcinogenic in animals, but there is no evidence that it causes cancer in humans. 2-Chlorothiazole binds to the nicotinic acetylcholine receptor and blocks the neurotransmitter acetylcholine, which results in paralysis and death of insects. It has also been shown to have neonicotinoid properties. 2-Chlorothiazole is soluble in methanol and can be quantified using kinetic data or an analytical method involving human urine as a sample matrix. The reactivity of 2-chlorothiazole with hydrogen chloride yields chloromethyl ketone and chloride ions, which can be analyzed by gas chromatography/mass spectrometry (GC/MS). The chemical structure of 2-chlorothiazole consists of two chlorine atoms bonded to an amide group at one end and a single carbon at</p>

<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Aminoazepan-2-one hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>

<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>L-Phenylalanine benzyl ester hydrochloride is an ester of L-phenylalanine and benzoic acid. It has a solubility of 1.9g/L in water, 2.1g/L in methanol, and 0.8g/L in acetonitrile at 20°C. The melting point is 119°C to 120°C and the boiling point is 243°C to 244°C at atmospheric pressure. This compound can be synthesized by reacting formamide with L-phenylalanine chloride in the presence of hexamethylphosphoramide as a catalyst.</p>

<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromophenol is an organic compound that is a bromophenol. It is used as a fluorometric probe in wastewater treatment and as a tracer for metabolic pathways in the proximal tubules of the kidney. 3-Bromophenol has a molecular weight of 184.16 g/mol and has been shown to be metabolized by bacteria into 2,4-dihydroxyphenylacetic acid (2,4-DPA). 3-Bromophenol can also be synthesized from 2,4-dihydroxyphenylacetic acid using sodium hydroxide solution and carbon source in a synthetic process. This synthetic process can be carried out at room temperature and atmospheric pressure.</p>

<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>H-Leu-Met-NH2 is a catecholamine that is found in the central nervous system and functions as a neurotransmitter. It has been shown to induce contractile response when injected into the carotid artery, with a maximal effect at doses of 0.5-5 mg/kg. The effect of H-Leu-Met-NH2 on cardiovascular function has not been studied. Catecholamines are also involved in other physiological processes, including regulation of blood pressure and respiration. This compound was originally isolated from adrenal glands and is found in plants such as beans and peas. The structure of this compound can be described as an h-leu-[met]-amide with a hydrochloride salt at the c-terminus.</p>

<p>Oxazine 170perchlorate is a magnetic resonance imaging contrast agent. It has a high molecular weight and a cyclic structure consisting of two oxazine moieties connected by a chloride bridge. This molecule can be reconstituted in water or an organic solvent, such as tetrahydrofuran, to give a constant concentration of 170mg/ml. Oxazine 170perchlorate is stable in the presence of oxygen and radiation, but decomposes when heated to 200°C in the presence of dithionite. The protonation state of the molecule is pH dependent and changes with redox potential. Oxazine 170perchlorate exhibits fluorescence at 695nm when irradiated with light at 480nm and has been shown to have high relaxivity properties when used for MRI scans.</p>

<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>

<p>1-(5-Chloro-2-hydoxyphenyl)ethanone is a potent inhibitor of the antiapoptotic protein survivin. It binds to the carbonyl group of the molecule, which is located on the intramolecular hydrogen bond surface. This leads to conformational changes in the molecule and ternary complex formation, which eventually leads to apoptosis protein aggregation and activation. 1-(5-Chloro-2-hydoxyphenyl)ethanone has been shown to inhibit prostate cancer cells and has also been studied in clinical trials for its anticancer properties.</p>

<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>