Biochemicals and Reagents

p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.

The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.

FABP4 is a fatty acid binding protein that has been shown to be over-expressed in cancer tissues. The FABP4 inhibitor, BMS309403, has been shown to inhibit the enzyme activity of FABP4, leading to the accumulation of fatty acids in tumor cells. This leads to cellular death by triggering apoptosis and necrosis. In addition, FABP4 inhibitors have anti-atherosclerotic effects and are being studied for their potential use as anti-obesity agents. These drugs may also have beneficial effects on mitochondrial function and neuronal function.

A synthetic peptide for use as a blocking control in assays to test for specificity of CXADR antibody, catalog no. 70R-6982

Affinity purified Rabbit polyclonal MAPK 8/9 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM4 antibody, catalog no. 70R-1599

Mouse monoclonal PECR antibody

Mouse monoclonal CD34 antibody (PE)

The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.

Rat monoclonal CD150 antibody (biotin)

Sheep polyclonal 17b Estradiol 6 antibody

The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.

RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB antibody, catalog no. 70R-6025

CD90.2 antibody (Azide free) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5459

This antibody reacts with heavy chains on human IgG (gamma chain).

A synthetic peptide for use as a blocking control in assays to test for specificity of KLK6 antibody, catalog no. 70R-2466

A synthetic peptide for use as a blocking control in assays to test for specificity of GPSM2 antibody, catalog no. 70R-2234

KIR2DL3 antibody was raised in Rabbit using Human KIR2DL3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB11 antibody, catalog no. 70R-7353

A synthetic peptide for use as a blocking control in assays to test for specificity of PGM3 antibody, catalog no. 70R-3268

Affinity purified Rabbit polyclonal Fibrinogen gamma antibody

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of NSDHL antibody, catalog no. 70R-1783

Influenza A Antigen Capture ELISA for use in the research laboratory

CLSTN1 antibody was raised in Rabbit using Human CLSTN1 as the immunogen

The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.

A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1L antibody, catalog no. 70R-1642

A synthetic peptide for use as a blocking control in assays to test for specificity of CAP1 antibody, catalog no. 70R-5729

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A1 antibody, catalog no. 70R-6796

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

The MVD antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed using cutting-edge technology. This antibody specifically targets and binds to collagen, making it an essential tool for research and diagnostic purposes.

A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA4F antibody, catalog no. 70R-6852

Mad2L1 antibody is a highly specific monoclonal antibody that targets Mad2L1 protein. Mad2L1 is involved in various cellular processes, including cell cycle regulation and checkpoint control. This antibody can be used for research purposes in the field of Life Sciences to study the role of Mad2L1 in different biological pathways.

Rabbit polyclonal RPAP2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of UBD antibody, catalog no. 70R-5744

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINI2 antibody, catalog no. 70R-9424

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-4853

JP4-039 is a polymerase chain inhibitor that has been shown to have antimicrobial effects against bacteria. JP4-039 has been used as a model system for bowel disease and iron homeostasis in tissue culture. JP4-039 is also an effective and reactive proton donor, which can be used to treat ulceration, radiation injury, and other reactive conditions. JP4-039 is also known to inhibit ATP production by inhibiting the mitochondrial membrane potential.

Purified recombinant Mouse mIgG Protein

The SOCS3 antibody is a highly specific monoclonal antibody that has been developed for use in the field of life sciences. It is used to target and neutralize IL-17A, a cytokine involved in inflammatory responses. This specific antibody can be used in various applications, including as a therapeutic agent or as a research tool for studying IL-17A-mediated signaling pathways.

CGRP antibody was raised in guinea pig using synthetic human calcitonin gene related peptide as the immunogen.

MTNR1A antibody was raised in rabbit using the C terminal of MTNR1A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CDK5 antibody, catalog no. 20R-1202

Rabbit polyclonal TNR antibody

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

Purified Polyclonal SLC6A8 antibody

Rabbit polyclonal Cytochrome P450 39A1 antibody

TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

A synthetic peptide for use as a blocking control in assays to test for specificity of CHCHD1 antibody, catalog no. 70R-3971

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP6 antibody, catalog no. 70R-10033

Rabbit polyclonal PAK1/3 antibody (Thr402)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM161B antibody, catalog no. 70R-7080

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Mouse monoclonal FBP2 antibody

Affinity purified Rabbit polyclonal GRASP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS11D antibody, catalog no. 70R-1893

GOLM1 antibody was raised in Rabbit using Human GOLM1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM108 antibody, catalog no. 70R-1305

CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF186 antibody, catalog no. 70R-6682

CD22 antibody (Spectral Red) was raised in rat using CD22 as the immunogen.

BMS 819881 is a synthetic chemical compound, classified as a pharmaceutical agent. This compound originates from synthetic processes in medicinal chemistry, developed as part of a structured drug discovery program. Its mode of action involves inhibiting specific molecular targets related to metabolic pathways, which are impactful in regulating physiological processes at the cellular level.

NCG31955 is a heterocyclic compound that has been shown to be a potent inhibitor of the cytochrome P450 enzyme, which is involved in the oxidation of aromatic compounds. NCG31955 also has an inhibitory effect on the bacterial enzyme, DNA gyrase. This inhibition prevents the production of dsDNA and prevents cell division. NCG31955 has been shown to have activity against bacteria such as Mycobacterium tuberculosis and Mycobacterium avium complex.

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-5562

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0427 antibody, catalog no. 70R-4855

A synthetic peptide for use as a blocking control in assays to test for specificity of SASP antibody, catalog no. 70R-3449

Rabbit polyclonal VPS45 antibody

STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

NSC 162535 disodium is a synthetic compound, classified as a chemical agent. It is derived from chemical synthesis processes intended for research and experimental purposes. The compound acts through biochemical interactions that affect specific cellular pathways, making it of interest for a variety of investigative biological studies.

Peptide H-SDIIFFQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DKPTYFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RKKRRARRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FATTFYQHLADSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CMVpp65 - 58 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-ESGGGGSPGRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Helospectin I is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-IYTWIEDHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NVNDVIAPAFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-GKQGGKAR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Lagosin is a polyene antibiotic that has been shown to have antimicrobial activity against Gram-positive and Gram-negative bacteria. This drug has been used in the treatment of infectious diseases, such as septicemia or meningitis caused by bacterial infections. Lagosin is active against bacteria that are resistant to other antibiotics because it interacts with the cell wall and causes cell lysis. The mechanism of action for Lagosin is similar to that of amphotericin B and nystatin, which are also polyene antibiotics. The antibacterial activity of this drug may be due to its ability to interact with cells and cause cell lysis. Lagosin has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.

Bio-013077-01 is a bioactive compound, which is a naturally derived product sourced from marine organisms. Its mode of action involves functioning as an enzyme inhibitor, capable of selectively binding to specific target enzymes and altering their activity. This mechanism allows it to modulate biochemical pathways that are crucial for various physiological and pathological processes.

Peptide H-TFAEALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KSTGKANKITITNDKGRLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rabbit polyclonal ISG15 antibody (HRP)

CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen

Inhibitor of HMG-CoA reductase

Peptide H-CGKLFGTSGQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal INPP1 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Affinity purified Rabbit polyclonal Tetraspan 1 antibody