Biochemicals and Reagents

Paeonol-d3 is a useful research tool for studying protein interactions, ion channels, and cell biology. It is also used as a pharmacological agent for the treatment of inflammation and cancer. Paeonol-d3 has been shown to be an agonist at GABA receptors, which are known to play a role in pain regulation. This drug also can inhibit the production of prostaglandin E2 (PGE2) by inhibiting cyclooxygenase-1 (COX-1) and COX-2 enzymes.

Ferrostatin-1 diyne is a research tool that is used for the study of protein interactions. It is also an activator and ligand in cell biology, which has been shown to bind to receptors and ion channels. Ferrostatin-1 diyne is a high purity chemical compound with a purity of >98% by HPLC. It has been shown to inhibit the activity of ion channels, such as Shaker potassium channel, KcsA potassium channel, and voltage-gated calcium channel. Ferrostatin-1 diyne has been used in pharmacology studies for its ability to inhibit peptides from interacting with other peptides or proteins.br>br>

SHIN 1New is an advanced therapeutic compound, originating from synthetic chemical processes, designed for intricate bioactivity modulation. It operates through a selective mechanism of action that targets and modulates specific molecular pathways, allowing scientists to investigate biological processes with high precision. This compound is utilized primarily in pharmaceutical research and development, where it serves as a critical tool for understanding the pathways and molecular interactions implicated in disease mechanisms. The precision and specificity it offers make it invaluable for experimental therapeutics, and its applications extend to drug discovery and the development of personalized medicine approaches. SHIN 1New's unique attributes allow for enhanced interaction studies within cellular environments, facilitating breakthroughs in the comprehension and manipulation of complex biological systems.

CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF11 antibody, catalog no. 70R-8322

Largazole is a ligand that binds to the ion channel TRPV4. It is an inhibitor of TRPV4 and prevents the activation of this receptor by its natural ligand, capsaicin. This inhibition has been shown to be competitive with capsaicin. Largazole also inhibits the activity of TRPV1, but does not inhibit TRPM8 or TRPA1 receptors. Largazole is also a potent activator of TRPA1 channels, which are activated by low pH, and can therefore be used as a research tool to study the effect of pH on pain sensation in animal models.
TRPV4 is widely expressed in many cell types such as neurons, astrocytes, vascular smooth muscle cells and immune cells. The binding of largazole to this receptor has been shown to activate various intracellular signaling pathways including PKCδ-dependent pathway and MAPK pathway.

Pdp-C1-pH-Val-Cit is a peptide that belongs to the class of ligands. It binds to a receptor and activates it, which leads to changes in the cell's physiology. Pdp-C1-pH-Val-Cit is used as a research tool for studying ion channels, receptors, and protein interactions. This ligand has been shown to be an activator of the GABAA receptor and an inhibitor of the NMDA receptor.

A synthetic peptide for use as a blocking control in assays to test for specificity of HSFY1 antibody, catalog no. 20R-1101

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A2 antibody, catalog no. 70R-7364

NSC 636819 is a histone deacetylase (HDAC) inhibitor that is used in cancer research. This drug has been shown to inhibit homologous recombination and growth factor-induced DNA repair by blocking the binding of HDAC1 to the substrate, thereby preventing histone deacetylation and reversing the effects of tumor suppressor genes. NSC 636819 also inhibits 2-hydroxyglutarate production, which leads to a higher rate of homologous recombination, leading to cell death. The administration of this drug has been shown to increase tumor size in mouse models with an IDH2 mutation. In addition, NSC 636819 has been shown to be effective in inhibiting cell proliferation in enteroendocrine cells and immunostaining for tgf-β.

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf91 antibody, catalog no. 70R-3475

7-[1-(2-Fluoropyridin-3-yl)-5-methyltriazol-4-yl]quinoline is a research tool used to study the interactions between ligands and their receptors. It can be used to identify the binding site on a receptor by its ability to activate or inhibit an ion channel, which is important for pharmacology. 7-[1-(2-Fluoropyridin-3-yl)-5-methyltriazol-4-yl]quinoline has also been shown to bind to antibodies and proteins, as well as interacting with cell membranes.

A synthetic peptide for use as a blocking control in assays to test for specificity of SAE1 antibody, catalog no. 70R-3174

Heat Shock Protein-90 alpha (HSP-90α) is a molecular chaperone protein that is involved in the folding and stabilization of proteins. HSP-90α is a member of the HSP family, which are known to be involved in many processes such as apoptosis, cell cycle regulation, DNA repair, and intracellular signaling. HSP-90α has been shown to inhibit the replication of viruses such as HIV by binding to viral proteins and preventing their assembly into virus particles. This protein also has antiviral effects on other viruses such as influenza and herpes simplex virus type 1.

1-(2-Chloroethyl)-1H-pyrrole-2,3-dicarboxylic acid is an inhibitor of ion channels. It has been shown to inhibit potassium and calcium channels, with IC 50 values of 0.4 μM and 1.4 μM respectively. 1-(2-Chloroethyl)-1H-pyrrole-2,3-dicarboxylic acid also inhibits the binding of acetylcholine to nicotinic receptors in the neuromuscular junction with an IC 50 value of 2 μM. This drug is a ligand for the benzodiazepine receptor and may act as a partial agonist or antagonist for this receptor at high concentrations.

TENOVIN-5 is a peptide inhibitor of the P2X7 receptor. It is a high purity, stable, and water insoluble compound that can be used as a research tool to study protein interactions, ligand binding and activation of the P2X7 receptor. TENOVIN-5 has been shown to bind to the extracellular domain of the P2X7 receptor and inhibit its function. TENOVIN-5 also activates the P2Y1 receptor in a dose-dependent manner.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT16 antibody, catalog no. 70R-9790

CEP68 antibody was raised in Rabbit using Human CEP68 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494

A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375

S-(4-Carboxybutyl)-D,L-homocysteine (S-CBBH) is a synthetic compound that has been shown to activate ion channels and inhibit ligand binding. It has also shown to be an effective inhibitor of the receptor for interleukin-1 (IL-1). S-CBBH binds to a specific site on the IL-1 receptor and inhibits IL-1 binding, thereby preventing activation of the receptor. This can lead to decreased inflammation in response to IL-1.

HIST3H2A antibody was raised in Rabbit using Human HIST3H2A as the immunogen

ELISA Kit for detection of SCF in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519

Oxazepam antibody was raised in mouse using BZO-BSA as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALNT2 antibody, catalog no. 70R-5374

TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

TT 232 is an advanced semiconductor characterization instrument, which is a critical tool in the field of materials science and electrical engineering. This product is sourced from the latest innovations in semiconductor technology, designed to provide comprehensive analysis of material properties. With a sophisticated mode of action, TT 232 employs high-resolution electrical measurements to assess parameters such as carrier concentration, mobility, and defect levels within semiconductor materials.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A15 antibody, catalog no. 70R-6262

A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407

APAF1 antibody was raised in Rabbit using Human APAF1 as the immunogen

Purified recombinant DKK2 protein (His tag)

BCAR1 antibody was raised in Rabbit using Human BCAR1 as the immunogen

The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.

DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

A synthetic peptide for use as a blocking control in assays to test for specificity of USP36 antibody, catalog no. 70R-3767

The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.

The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.

1-316 amino acids: MATFVELSTK AKMPIVGLGT WKSPLGKVKE AVKVAIDAGY RHIDCAYVYQ NEHEVGEAIQ EKIQEKAVKR EDLFIVSKLW PTFFERPLVR KAFEKTLKDL KLSYLDVYLI HWPQGFKSGD DLFPKDDKGN AIGGKATFLD AWEAMEELVD EGLVKALGVS NFSHFQIEKL LNKPGLKYKP VTNQVECHPY LTQEKLIQYC HSKGITVTAY SPLGSPDRPW AKPEDPSLLE DPKIKEIAAK HKKTAAQVLI RFHIQRNVIV IPKSVTPARI VENIQVFDFK LSDEEMATIL SFNRNWRACN VLQSSHLEDY PFDAEY

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

Yangambin is an acetate extract of the plant yangambin. Yangambin has been shown to have anti-cancer effects in vitro and in vivo, including a reduction in cell proliferation, differentiation and migration. It also has anti-inflammatory properties. This extract was studied on mice with squamous carcinoma and found to inhibit tumor growth. Yangambin is also known for its ability to stimulate the immune system by activating toll-like receptors (TLRs) that are involved in the recognition of pathogens. Yangambin activates TLR2, TLR4, and TLR9 pathways and induces a pro-inflammatory response against Leishmania parasites.

The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.

Human HMGB1(High mobility group protein B1) ELISA Kit

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273

Human IgE is a hormone peptide that plays a crucial role in immune response and allergic reactions. It is a protein that belongs to the immunoglobulin family and is involved in the activation of various immune cells. Human IgE specifically recognizes and binds to antigens, triggering an immune response against them. Monoclonal antibodies targeting human IgE have been developed for therapeutic purposes. These antibodies can neutralize the effects of IgE, reducing allergic reactions and symptoms associated with allergies such as asthma, hay fever, and hives. They work by blocking the binding of IgE to its receptors on immune cells, preventing the release of inflammatory mediators. In addition to their therapeutic applications, human IgE and its monoclonal antibodies are widely used in research and diagnostic laboratories. They are valuable tools for studying immune responses, identifying specific allergens, and detecting the presence of autoantibodies or infections caused by microorganisms like Mycoplasma genitalium. Our purified human IgE products are carefully

A synthetic peptide for use as a blocking control in assays to test for specificity of TBL1Y antibody, catalog no. 70R-9103

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2B antibody, catalog no. 70R-4662

A synthetic peptide for use as a blocking control in assays to test for specificity of ABAT antibody, catalog no. 70R-2609

A synthetic peptide for use as a blocking control in assays to test for specificity of PAX8 antibody, catalog no. 70R-1960

Rat monoclonal CD8 antibody (FITC); IgG2b kappa

A synthetic peptide for use as a blocking control in assays to test for specificity of FSCN3 antibody, catalog no. 70R-9247

A synthetic peptide for use as a blocking control in assays to test for specificity of NSMCE1 antibody, catalog no. 70R-1645

Rimtuzalcap is a monoclonal antibody, which is derived from a hybridoma technology involving the fusion of specific immune cells. It operates through the highly specific binding to a targeted antigen, thereby modulating immune responses or interfering with signaling pathways. This precision in action enhances its efficacy and minimizes off-target effects compared to broader immunomodulatory agents.

The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.

The AIMP1 antibody is a monoclonal antibody that targets TNF-related apoptosis-inducing protein (TRAIL). It is commonly used in life sciences research and has applications in various fields. The AIMP1 antibody specifically binds to TNF-α, a cytokine involved in inflammation and cell death processes. By targeting TNF-α, the AIMP1 antibody can modulate apoptosis, making it a valuable tool for studying cell signaling pathways and exploring potential therapeutic interventions.

Rabbit polyclonal RBM41 antibody

EDN3 antibody was raised in rabbit using the C terminal of EDN3 as the immunogen

The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ35767 antibody, catalog no. 70R-4288

A synthetic peptide for use as a blocking control in assays to test for specificity of MARCO antibody, catalog no. 70R-8509

Mouse monoclonal HMOX2 antibody

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K2 antibody, catalog no. 70R-2007

A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 20R-1231

A synthetic peptide for use as a blocking control in assays to test for specificity of TMTC4 antibody, catalog no. 70R-6734

Affinity purified Rabbit polyclonal Interferon alpha 6 antibody

His tag antibody was raised in rabbit using 6-His (HHHHHH) conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-7272

BCL7B antibody was raised in Rabbit using Human BCL7B as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture

A synthetic peptide for use as a blocking control in assays to test for specificity of TEX264 antibody, catalog no. 70R-7352

Sheep polyclonal DNM1 antibody (Ser778)

The GAPDH antibody is a highly specific monoclonal antibody that is used for various applications in the field of Life Sciences. This antibody has been extensively tested and validated using human serum samples, making it a reliable tool for research. It binds specifically to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis and other cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of Cpne6 antibody, catalog no. 70R-9780

A synthetic peptide for use as a blocking control in assays to test for specificity of ALX3 antibody, catalog no. 20R-1182

The NME1 protein is an antigen that belongs to the group of Recombinant Proteins & Antigens. It contains specific epitopes that can be recognized by antibodies in human serum. This protein has a suppressive effect on viral replication and is considered to have antiviral properties. It is composed of a sequence of amino acid residues that are important for its biological activity. The NME1 protein can be used in various applications in the Life Sciences field, such as research studies and diagnostic assays. Its specific antibody can be detected using techniques like matrix-assisted laser desorption/ionization (MALDI) or lysosomal acid residues analysis.

Mouse monoclonal CTDSP1 antibody

Affinity purified Rabbit polyclonal PPID antibody

ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA2A antibody, catalog no. 70R-9945

A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL4 antibody, catalog no. 70R-7155

Purified recombinant Human VASP protein

The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of SNX5 antibody, catalog no. 70R-5748

Purified recombinant Human SAR1B protein (His tag)

SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Asp-AMS is a molecule that has been found to be present in human mitochondria. This molecule has been shown to have an inhibitory effect on the synthesis of bacterial proteins, including those that are involved in the production of toxins, which may be due to its ability to bind with these proteins and prevent their function. Asp-AMS also inhibits the production of inflammatory molecules that are responsible for autoimmune diseases and other inflammatory disorders. The binding of this molecule with specific enzymes has been observed using polymerase chain reaction (PCR) techniques on bacteria isolated from infected patients. These enzymes include target enzymes such as subtilisin and acid phosphatase, which are involved in protein synthesis, fatty acid metabolism, and immune response. It is also known that Asp-AMS can be sequenced by mass spectrometry techniques.

Affinity purified Rabbit polyclonal HHEX antibody

HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM38 antibody, catalog no. 70R-4914