Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
MCP2 antibody
MCP2 antibody was raised in mouse using highly pure recombinant human MCP-2 as the immunogen.
AKTIP antibody
AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
HPSE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HPSE antibody, catalog no. 70R-10171
Purity:Min. 95%SLC16A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC16A1 antibody, catalog no. 70R-6795
Purity:Min. 95%25OH Vitamin D2/D3 Antigen-Biotin conjugate
Total Vitamin D Derivative-Biotin ConjugatePurity:Min. 95%Myostatin Propeptide protein
Region of Myostatin Propeptide beta protein corresponding to amino acids MNENSEQKEN VEKEGLCNAC TWRQNTKSSR IEAIKIQILS KLRLETAPNI SKDVIRQLLP KAPPLRELID QYDVQRDDSS DGSLEDDDYH ATTETIITMP TESDFLMQVD GKPKCCFFKF SSKIQYNKVV KAQLWIYLRP VETPTTVFVQ ILRLIKPMKD GTRYTGIRSL KLDMNPGTGI WQSIDVKTVL QNWLKQPESN LGIEIKALDE NGHDLAVTFP GPGEDGLNPF LEVKVTDTPK RSRR.
Purity:Min. 95%AKR1B10 antibody
AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
FBXO39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO39 antibody, catalog no. 70R-3430
Purity:Min. 95%GNL3L antibody
GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Biotin-SARS-CoV-2 Spike RBM 480-496 peptide
Biotin-SARS-CoV-2 Spike RBM 480-496 (Biotin-LC) peptide is the biotinylated version of SARS-CoV-2 Spike RBM 480-496 peptide. SARS-CoV-2 Spike RBM 480-496 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Motif (RBM). Biotin-SARS-CoV-2 Spike RBM 480-496 peptide is useful for vaccine development and for structure-activity relationship studies
SARS-CoV-2 Spike (S) glycoprotein
Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.
With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.
SARS-CoV-2 Spike RBM:
The receptor-binding domain in SARS-CoV-2 Spike protein contains a receptor-binding motif RBM. SARS-CoV-2 Spike RBM is the main functional motif in RBD and allows contacts between the S protein and the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.Thiol-dPEG®8-Acid
CAS:Thiol-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Purity:Min. 95%Molecular weight:322.39 g/molCUR 61414
CAS:Antagonist of hedgehog signaling pathway activator Smoothened; antineoplastic
Formula:C31H42N4O5Purity:Min. 95%Molecular weight:550.69 g/molRef: 3D-FB20593
Discontinued productALDH7A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH7A1 antibody, catalog no. 70R-4025
Purity:Min. 95%CCR4 antibody
The CCR4 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize neurotrophic factors in the body. It specifically targets and inhibits the activity of TGF-β1, a key factor involved in cholinergic signaling. This antibody binds to specific receptor molecules on cells, preventing the activation of downstream signaling pathways and ultimately leading to a reduction in neurotrophic factor activity.
Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.
Purity:Min. 95%Caspase 1 antibody
Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.
AKAP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-2673
Purity:Min. 95%USP4 antibody
USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Mycoplasma pneumoniae protein
Mycoplasma pneumoniae protein is a versatile compound with various characteristics and applications in the field of Life Sciences. It has been found to interact with cholinergic receptors, E-cadherin, insulin, and globulin, making it a valuable tool for studying cellular interactions and signaling pathways. This protein can be used in electrode-based assays to measure specific biological responses or as a target for neutralizing antibodies in immunological studies. Additionally, Mycoplasma pneumoniae protein has been shown to modulate the activity of β-catenin, an important regulator of cell adhesion and gene expression. Its acetyltransferase activity has also been implicated in the regulation of parathyroid hormone-related protein levels. With its polymorphic nature and ability to bind to fibronectin, this protein offers great potential for research purposes across various disciplines within Life Sciences.Scamp1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Scamp1 antibody, catalog no. 70R-9784
Purity:Min. 95%PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
CD45 antibody
CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.
DUOXA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DUOXA1 antibody, catalog no. 70R-10265
Purity:Min. 95%Oxytocin antibody
The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.
OXSM antibody
OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
Estradiol ELISA kit
ELISA kit for the detection of Estradiol in the research laboratory
Purity:Min. 95%PHLDA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHLDA2 antibody, catalog no. 70R-6017
Purity:Min. 95%USP47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of USP47 antibody, catalog no. 70R-9744
Purity:Min. 95%GABRA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GABRA4 antibody, catalog no. 70R-5205
Purity:Min. 95%RBMX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBMX antibody, catalog no. 70R-10373
Purity:Min. 95%TAPBP antibody
TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
Purity:Min. 95%CLDN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN2 antibody, catalog no. 20R-1258
Purity:Min. 95%LETMD1 antibody
LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED
Purity:Min. 95%CD63 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD63 antibody, catalog no. 70R-10168
Purity:Min. 95%P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
CX40.1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CX40.1 antibody, catalog no. 70R-1697
Purity:Min. 95%A1CF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of A1CF antibody, catalog no. 70R-4765
Purity:Min. 95%CD29 antibody
The CD29 antibody is a highly effective monoclonal antibody that has multiple applications in the field of biotechnology. It can be used as a growth factor, a cdk4/6 inhibitor, and an antiviral agent. The CD29 antibody contains excipients such as globulin, which enhance its stability and efficacy. This powerful antibody has neutralizing properties and can effectively target molecules involved in various biological processes.
Heparin Binding Protein antibody
The Heparin Binding Protein antibody is a monoclonal antibody used in Life Sciences research. It specifically targets myostatin, a protein involved in muscle growth regulation. This antibody is highly specific and can be used for various applications, including Western blotting, immunohistochemistry, and ELISA assays. The Heparin Binding Protein antibody has been validated for its performance and reliability in detecting myostatin in samples from various species. It can be used to study the role of myostatin in muscle development, regeneration, and diseases such as muscular dystrophy. The antibody has been tested using electrochemical impedance spectroscopy with an electrode coated with heparin-binding protein. It has shown excellent binding affinity and specificity towards the target protein. Furthermore, the Heparin Binding Protein antibody does not cross-react with other chemical agents or cation channels commonly found in biological samples. This makes it a valuable tool for researchers studying myostatin-related pathways and therapeutic interventions.Lamin antibody
Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.
Bacillus Anthracis (Anthrax) protein (Protective Antigen)
Purified recombinant Bacillus Anthracis (Anthrax) protein (Protective Antigen)Purity:Min. 95%ST6GALNAC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC4 antibody, catalog no. 70R-7277
Purity:Min. 95%TSHR antibody
TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
IL2 antibody
IL2 antibody was raised in goat using highly pure recombinant human IL-2 as the immunogen.
Purity:Min. 95%ApoA-II protein
ApoA-II protein is a globulin that belongs to the class of Proteins and Antigens. It is primarily synthesized in the liver and plays a crucial role in lipid metabolism. ApoA-II protein interacts with lecithin, forming high-density lipoprotein (HDL) particles that are responsible for transporting cholesterol from peripheral tissues to the liver for excretion. This protein undergoes recombination, resulting in various isoforms with different amino acid substitutions.Purity:Min. 95%SLC20A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC20A2 antibody, catalog no. 70R-7534
Purity:Min. 95%Transferrin antibody
Transferrin antibody was raised in rabbit using human transferrin as the immunogen.
Purity:Min. 95%Serglycin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRGN antibody, catalog no. 70R-5024
Purity:Min. 95%Tau antibody
The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.
Purity:Min. 95%C2ORF18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf18 antibody, catalog no. 70R-7420
Purity:Min. 95%Candesartan-d5
CAS:Candesartan-d5 is a peptide that binds to the angiotensin II receptor, which is found in many tissues including the vasculature of the lungs and kidneys. This drug blocks the binding of angiotensin II to its receptor, thereby inhibiting vasoconstriction, increasing urine volume and decreasing blood pressure. Candesartan-d5 has been shown to have high purity with a purity greater than 99%. It is used in research as an activator for antibodies, as well as a ligand or receptor for pharmacological studies.
Formula:C24H20N6O3Purity:Min. 95%Molecular weight:445.5 g/molRef: 3D-PXB65058
Discontinued productC16ORF71 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf71 antibody, catalog no. 70R-3221
Purity:Min. 95%FADD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fadd antibody, catalog no. 70R-3423
Purity:Min. 95%HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.ZNF101 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF101 antibody, catalog no. 70R-8101
Purity:Min. 95%PAPPA antibody
PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%ATPIF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATPIF1 antibody, catalog no. 70R-5303
Purity:Min. 95%GJD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJD4 antibody, catalog no. 70R-6187
Purity:Min. 95%Imatinib para-diaminomethylbenzene impurity-d3
CAS:Imatinib is a small molecule drug that binds to the ATP-binding site of tyrosine kinase and inhibits the activity of protein tyrosine kinases. Imatinib is used for the treatment of chronic myeloid leukemia (CML) and gastrointestinal stromal tumors (GIST). Imatinib impurity D3 is a by-product formed during synthesis, which can be removed by purification. The purity level of imatinib is 99.5% or greater, with an impurity level of less than 0.5%.
Formula:C29H32N7OPurity:Min. 95%Molecular weight:497.6 g/molRef: 3D-WZB81927
Discontinued productSin3b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sin3b antibody, catalog no. 70R-8194
Purity:Min. 95%EIF3S9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3S9 antibody, catalog no. 70R-4767
Purity:Min. 95%Endothelin 1 antibody
The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.
Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
GLIS3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLIS3 antibody, catalog no. 20R-1239
Purity:Min. 95%ID3 antibody
The ID3 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important marker for activated astrocytes in the central nervous system. This antibody plays a crucial role in various life sciences research, particularly in studying the functions and interactions of astrocytes in different physiological and pathological conditions. Additionally, the ID3 antibody has been extensively used in adipose tissue research to investigate the role of astrocytes in regulating fatty acid metabolism and adipogenesis. Its high specificity and affinity make it an invaluable tool for scientists working in these fields.Cytokeratin 75 antibody
Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI
FLJ30934 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ30934 antibody, catalog no. 70R-9331
Purity:Min. 95%ADORA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA1 antibody, catalog no. 70R-9943
Purity:Min. 95%
