Biochemicals and Reagents

Affinity purified Rabbit polyclonal Munc 13 4 antibody

Prothrombin fragment 1 antibody was raised in sheep using human Prothrombin purified from plasma as the immunogen.

The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.

Region of Persephin protein corresponding to amino acids ALSGPCQLWS LTLSVAELGL GYASEEKVIF RYCAGSCPRG ARTQHGLALA RLQGQGRAHG GPCCRPTRYT DVAFLDDRHR WQRLPQLSAA ACGCGG.

ARSB antibody was raised in Rabbit using Human ARSB as the immunogen

Affinity purified Rabbit polyclonal MAPK3 antibody

Affinity purified Rabbit polyclonal CKLFSF5 antibody

HYLS1 antibody was raised in Rabbit using Human HYLS1 as the immunogen

The Podocin antibody is a cytotoxic monoclonal antibody used in Life Sciences. It is specifically designed to target VEGF (vascular endothelial growth factor) and inhibit its activity. This antibody has been extensively studied for its glycosylation patterns and its interaction with other growth factors, such as epidermal growth factor. The Podocin antibody has shown promising results in inhibiting the activity of arginase, an enzyme involved in the metabolism of arginine. It can be used in various research applications, including electrophoresis and immunohistochemistry. With its high specificity and affinity, this monoclonal antibody offers a valuable tool for researchers working in the field of growth factors and angiogenesis.

A synthetic peptide for use as a blocking control in assays to test for specificity of AK3L1 antibody, catalog no. 70R-1088

Rabbit polyclonal GPR160 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DDC antibody, catalog no. 70R-3369

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS9 antibody, catalog no. 70R-4884

A synthetic peptide for use as a blocking control in assays to test for specificity of GJB2 antibody, catalog no. 70R-1685

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR87 antibody, catalog no. 70R-10121

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM59 antibody, catalog no. 70R-6350

Bradykinin is a peptide hormone that is released by the cells in the walls of blood vessels in response to injury. Bradykinin causes contraction of smooth muscle and dilation of blood vessels, which results in an increase in blood pressure. Bradykinin also stimulates the release of stomach acid, which can lead to ulcers and bleeding. This product does not contain any impurities or contaminants and has been shown to be a potent activator for ion channels.

A synthetic peptide for use as a blocking control in assays to test for specificity of COPA antibody, catalog no. 70R-6205

The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.

LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL

F12 antibody was raised in Rabbit using Human F12 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of GAPDHS antibody, catalog no. 70R-3034

A synthetic peptide for use as a blocking control in assays to test for specificity of Necap1 antibody, catalog no. 70R-9317

Rabbit polyclonal GRIA2/3 antibody

The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of A1CF antibody, catalog no. 70R-4765

GR 64349 is a non-selective cation channel blocker that binds to the voltage-dependent calcium channels in mammalian cells. It inhibits the influx of calcium ions into these cells, which may lead to an antiemetic effect by reducing the release of acetylcholine and histamine from nerve terminals in the brain stem. GR 64349 has also been shown to have an inhibitory effect on autoimmune diseases, such as psoriasis, rheumatoid arthritis, and multiple sclerosis. Clinical trials are underway for GR 64349 as a potential treatment for bladder dysfunction in patients with spinal cord injury.

The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E2 antibody, catalog no. 70R-9622

STX1A antibody was raised in rabbit using the N terminal of STX1A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD51L3 antibody, catalog no. 70R-10335

A synthetic peptide for use as a blocking control in assays to test for specificity of CHIA antibody, catalog no. 70R-5921

The MBP antibody is a highly specialized antibody that targets and neutralizes myelin basic protein (MBP). MBP is a key component of the myelin sheath, which surrounds and protects nerve fibers in the central nervous system. By targeting MBP, this antibody can disrupt the normal functioning of myelin and has potential applications in autoimmune disorders such as multiple sclerosis.

Thiopilocarpine is a muscarinic receptor agonist that is used in the treatment of insulin resistance and metabolic disorders. It has been shown to modulate acetylcholine concentration-response curves in tissues, and can be used as an aid in diagnosing these conditions. Thiopilocarpine also binds to the muscarinic M1 receptor and stimulates leukotriene D4 production. This drug does not cross the blood-brain barrier, which limits its use in treating neurological disorders.

CPSF2 antibody was raised in Rabbit using Human CPSF2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ACO1 antibody, catalog no. 70R-4994

A synthetic peptide for use as a blocking control in assays to test for specificity of ME2 antibody, catalog no. 70R-2512

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM5 antibody, catalog no. 70R-8274

Strictosidine is a monoterpenoid indole alkaloid that is found in the plant genus Palicourea. It has been shown to inhibit enzyme activities in the bacteria Staphylococcus aureus and Escherichia coli, which are responsible for the production of fatty acids, as well as tissue culture cells. Strictosidine has been shown to have anti-cancer activity and may be used for the treatment of insulin resistance. This compound belongs to a group of iridoid glucosides that are found in plants from the family Apocynaceae. The chemical structure of strictosidine is similar to other iridoid glucosides, such as vincamine and periwinkle alkaloids.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM47 antibody, catalog no. 70R-4958

The CAV1 antibody is a highly specialized medicament that is used in various research and diagnostic applications. It specifically targets caveolin-1, a protein that plays a crucial role in cell signaling and membrane trafficking. The CAV1 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.

Rabbit Polyclonal GSK3 beta antibody (Tyr216)

The TLR8 antibody is a specific antibody used in Life Sciences to neutralize the activity of Toll-like receptor 8 (TLR8). TLR8 plays a crucial role in the immune response by recognizing and binding to various pathogen-associated molecular patterns. This antibody has been shown to inhibit the activation of TLR8 by blocking its interaction with ligands such as single-stranded RNA. By doing so, it prevents downstream signaling pathways that lead to the production of inflammatory cytokines like TNF-α and chemokines. Additionally, this antibody has been found to modulate collagen synthesis, fibronectin expression, and epidermal growth factor (EGF)-like growth factors. Its versatility makes it an essential tool for research in immunology and related fields.

26-185 amino acids: MRNAEGDDPT NLESALIGKP VPKFRLESLD NPGQFYQADV LTQGKPVLLN VWATWCPTCR AEHQYLNQLS AQGIRVVGMN YKDDRQKAIS WLKELGNPYA LSLFDGDGML GLDLGVYGAP ETFLIDGNGI IRYRHAGDLN PRVWEEEIKP LWEKYSKEAA Q

Purified Polyclonal AKAP10 antibody

Affinity purified Rabbit polyclonal NSUN6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf182 antibody, catalog no. 70R-3111

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM54A antibody, catalog no. 70R-3511

A synthetic peptide for use as a blocking control in assays to test for specificity of ASB17 antibody, catalog no. 70R-4574

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA9 antibody, catalog no. 70R-8268

A synthetic peptide for use as a blocking control in assays to test for specificity of OPA3 antibody, catalog no. 70R-9898

A synthetic peptide for use as a blocking control in assays to test for specificity of LIN9 antibody, catalog no. 70R-9005

A synthetic peptide for use as a blocking control in assays to test for specificity of GRAMD2 antibody, catalog no. 70R-6309

The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.

Pecazine is a nonsteroidal anti-inflammatory drug that is used to treat bowel disease. It inhibits the protease activity of inflammatory cells, which causes the release of inflammatory substances such as prostaglandins and leukotrienes. Pecazine also reduces the redox potential in the body, which may be due to its ability to inhibit oxidative enzyme activity. This drug has been shown to be effective in treating inflammatory bowel disease.

A synthetic peptide for use as a blocking control in assays to test for specificity of Tbcb antibody, catalog no. 70R-9129

A synthetic peptide for use as a blocking control in assays to test for specificity of MAX antibody, catalog no. 70R-8413

PGM5 antibody was raised in rabbit using the N terminal of PGM5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of APP antibody, catalog no. 70R-6194

A synthetic peptide for use as a blocking control in assays to test for specificity of OR13C5 antibody, catalog no. 70R-7872

Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF9 antibody, catalog no. 70R-10317

The Androgen Receptor antibody is a neutralizing monoclonal antibody that targets the androgen receptor, a protein involved in the regulation of male sexual development and function. This antibody has been shown to inhibit the activity of the androgen receptor, leading to decreased growth factor signaling and reduced expression of genes regulated by androgens.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF582 antibody, catalog no. 70R-8112

N terminal of murine Adipophillin.

A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf19 antibody, catalog no. 70R-4349

NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

Galanin-like peptide (GLP-1) is a human peptide that is a potent activator of the GLP-1 receptor. GLP-1 functions as a ligand for the GLP-1 receptor, which is coupled to G proteins. The activation of this receptor leads to increased calcium influx, which in turn triggers the release of insulin from pancreatic beta cells. GLP-1 also inhibits gastric acid secretion and motility, and functions as an inhibitor of glucagon secretion.
GLP-1 has been shown to be a potent inhibitor of ion channels. It binds to Kv3 potassium channels and voltage gated sodium channels, inhibiting their activity by binding to their pore region. In addition, GLP-1 inhibits amyloid beta production by inhibiting protein synthesis in rat brain cells.

Affinity purified Rabbit polyclonal ADRA1C antibody

Rabbit polyclonal PLD1 antibody (Ser561)

ELISA kit for detection of CXCL10 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of C12orf42 antibody, catalog no. 70R-4216

A synthetic peptide for use as a blocking control in assays to test for specificity of DLL1 antibody, catalog no. 70R-6123

Rabbit polyclonal RANBP3L antibody

PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.

ONC206 is a human mitochondrial-derived compound that has potent antitumor activity. It has been shown to rapidly decrease the mitochondrial membrane potential, which is critical for energy metabolism and cell viability. ONC206 also disrupts cellular processes involved in cancer cell proliferation, including the up-regulation of genes related to cancer cell growth and survival. ONC206 is chemically stable and does not affect normal cells. This drug exhibits synergistic effects with other anticancer drugs and may be useful for treating pediatric cancers as well as brain tumors.

Rabbit polyclonal IRX1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of BACE2 antibody, catalog no. 70R-6662

CCNI2 antibody was raised in Rabbit using Human CCNI2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MUS81 antibody, catalog no. 70R-10314

PDCD8 antibody was raised in rabbit using the N terminal of PDCD8 as the immunogen

Affinity purified Rabbit polyclonal PDYN antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT2B antibody, catalog no. 70R-8496

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPDL antibody, catalog no. 70R-4655

A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC1 antibody, catalog no. 70R-6287

Affinity purified Rabbit polyclonal SOCS5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPN1 antibody, catalog no. 70R-6625

OVCA2 Antibody

The PAWR antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been found to be effective in neutralizing autoantibodies, stimulating colony growth, and regulating the epidermal growth factor. Additionally, this antibody has shown promising results in inhibiting caspase-9 activity, which is essential for apoptosis.

Rabbit polyclonal CLPT1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GADL1 antibody, catalog no. 70R-4286