Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
KCNA10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA10 antibody, catalog no. 70R-1497
Purity:Min. 95%Parietal Cell ELISA kit
ELISA kit for the detection of Parietal Cell in the research laboratory
Purity:Min. 95%KDM1A (508-524) Heavy
Lysine-specific histone demethylase 1A (LSD1) or lysine (K)-specific demethylase 1A (KDM1A) is a protein in humans that encodes a flavin-dependent monoamine oxidase. The KDM1A protein can demethylate mono- and di-methylated lysines, specifically histone 3, lysines 4 and 9. KDM1A has crucial roles in embryogenesis and tissue-specific differentiation, as well as oocyte growth. KDM1A also appears to play a clinically important role in epigenetic reprogramming zygote formation. Deletion of the gene for KDM1A can have effects on the growth and differentiation of embryonic stem cells. KDM1A is also thought to play a role in cancer, as poorer outcomes can be correlated with higher expression of this gene. Therefore, the inhibition of KDM1A may be a possible treatment for cancer.The arginine residue at position 17 of this peptide is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (4).
Purity:Min. 95%Molecular weight:1,927 g/molHBP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HBP1 antibody, catalog no. 70R-8294
Purity:Min. 95%UEVLD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UEVLD antibody, catalog no. 70R-3803
Purity:Min. 95%BMS 599626 hydrochloride
CAS:Inhibitor of HER1, HER2 and HER4 tyrosine kinases
Formula:C27H27FN8O3·HClPurity:Min. 95%Molecular weight:567.01 g/molChicken anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%ApoA1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Additionally, it has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
PDIA6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA6 antibody, catalog no. 70R-5406
Purity:Min. 95%MGC33926 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC33926 antibody, catalog no. 70R-1907
Purity:Min. 95%SFRS7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS7 antibody, catalog no. 70R-5017
Purity:Min. 95%PF-4693627
CAS:PF-4693627 is a potent, selective, and orally active prostaglandin E2 receptor agonist with pharmacological activity at the COX-2 enzyme. PF-4693627 has been shown to be effective in reducing inflammation and pain in animal models of inflammatory diseases, such as uveitis and arthritis. PF-4693627 is also being investigated for its potential use as an analgesic in humans. This drug has been shown to have a good safety profile in clinical studies.
PF-4693627 binds selectively to the prostaglandin E2 receptor subtype EP3 (COX-2) without significant binding to EP1 or EP2 receptors. This compound was developed by Pfizer Inc., which will be conducting Phase III clinical trials on this drug.Formula:C26H29Cl2N3O3Purity:Min. 95%Molecular weight:502.4 g/molRef: 3D-MCC81593
Discontinued productCNTNAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CNTNAP1 antibody, catalog no. 70R-6158
Purity:Min. 95%NOS2 antibody
The NOS2 antibody is a highly specialized autoantibody that targets the glycan structure of the EBNA1 protein. This polyclonal antibody is derived from plasmids and has been extensively studied for its genotoxic effects. It specifically recognizes and binds to the NOS2 protein, an important enzyme involved in nitric oxide production. The NOS2 antibody can be used in various life science applications, including research on interferon and interleukin-6 signaling pathways. Additionally, it is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their specific needs. Trust in the reliability and specificity of this antibody to enhance your experiments in the field of life sciences.
Lysozyme protein
Lysozyme protein is a versatile enzyme that plays a crucial role in various biological processes. It acts as an epidermal growth factor and hormone peptide, contributing to cell proliferation and differentiation. Lysozyme also exhibits neuroprotective properties by preventing the accumulation of dopamine, which can lead to neuronal damage when activated excessively.
Purity:>90% By Sds-Page.STAT6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STAT6 antibody, catalog no. 70R-7858
Purity:Min. 95%Plexin A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLXNA2 antibody, catalog no. 70R-6314
Purity:Min. 95%SNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431
Purity:Min. 95%WT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WT1 antibody, catalog no. 70R-8233
Purity:Min. 95%Dengue Virus IgM ELISA kit
ELISA kit for the detection of Dengue Virus IgM in the research laboratory
Purity:Min. 95%GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
FCN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FCN3 antibody, catalog no. 70R-5456
Purity:Min. 95%Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%RBMS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS2 antibody, catalog no. 70R-4740
Purity:Min. 95%C2orf25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-4055
Purity:Min. 95%ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purity:Min. 95%Recombinant Human IL-27/IL-35 (EBIV3)
Human sequence expressed in E. coli Cells; purity >90% by SDS-PAGE and HPLC.
GPR83 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPR83 antibody, catalog no. 70R-9680
Purity:Min. 95%Angiotensin (Human, 1-7)
CAS:Angiotensin (human, 1-7) is a peptide that acts as an agonist for the angiotensin II receptor. It is used in research as a pharmacological tool and in cell biology to study protein interactions and signaling pathways. It is also used to study the role of angiotensin receptors in various diseases such as hypertension and heart disease. Angiotensin (human, 1-7) is supplied at high purity and without any contaminants.
Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899 g/molMAP4K4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K4 antibody, catalog no. 70R-5785
Purity:Min. 95%CDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
PSMB9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB9 antibody, catalog no. 70R-5740
Purity:Min. 95%FZD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD2 antibody, catalog no. 70R-7184
Purity:Min. 95%WAY-169916
CAS:WAY-169916 is a novel, orally active, nonsteroidal anti-inflammatory drug (NSAID) that inhibits the activity of inflammatory genes by binding to and blocking the response element. WAY-169916 has shown efficacy in vivo in animal models of cardiac and renal diseases. It has also been shown to lower diastolic blood pressure in rats with chronic heart failure. WAY-169916's mechanism of action is not fully understood but may involve inhibition of the activity of 17β-estradiol and/or its receptor. This drug also has an antiinflammatory effect on bowel disease models in mice by inhibiting inflammation through mechanisms that are yet to be elucidated.
Formula:C17H13F3N2O2Purity:Min. 95%Molecular weight:334.29 g/molRef: 3D-UBB76418
Discontinued productChromogranin A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHGA antibody, catalog no. 70R-1565Purity:Min. 95%Slc6a9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc6a9 antibody, catalog no. 70R-8535
Purity:Min. 95%DULLARD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DULLARD antibody, catalog no. 70R-6260
Purity:Min. 95%Bovine IgG protein
Bovine IgG protein is a purified immunoglobulin that plays a crucial role in various biological processes. This protein has been extensively studied in the field of life sciences and has shown promising results. It has been found to be an effective inhibitor of TGF-beta, a growth factor that is responsible for various cellular functions such as cell proliferation and differentiation. Bovine IgG protein has also been shown to neutralize collagen-induced adipose tissue activation and inhibit nuclear translocation of c-myc, a protein involved in cell growth and proliferation.Purity:Min. 95%SYT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SYT1 antibody, catalog no. 70R-9778
Purity:Min. 95%14.3.3 tau protein
1-245 amino acids: MEKTELIQKA KLAEQAERYD DMATCMKAVT EQGAELSNEE RNLLSVAYKN VVGGRRSAWR VISSIEQKTD TSDKKLQLIK DYREKVESEL RSICTTVLEL LDKYLIANAT NPESKVFYLK MKGDYFRYLA EVACGDDRKQ TIDNSQGAYQ EAFDISKKEM QPTHPIRLGL ALNFSVFYYE ILNNPELACT LAKTAFDEAI AELDTLNEDS YKDSTLIMQL LRDNLTLWTS DSAGEECDAA EGAENPurity:Min. 95%IRX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8549
Purity:Min. 95%Rasfonin
CAS:Rasfonin is a natural product that was found in an extract of the plant Etoac. It has been shown to inhibit the growth of pancreatic cancer cells and have anticancer activity. Rasfonin is structurally similar to the anticancer drug temozolomide, but it does not have any known toxicity. Rasfonin binds to DNA and inhibits transcriptional activation by the nuclear factor-kappa B (NF-κB) pathway. It also induces autophagy, which is important for maintaining cellular homeostasis, preventing tumor formation, and inducing apoptosis. This compound has been shown to inhibit proliferation of normal as well as cancerous cells in vitro and in vivo.
Formula:C25H38O6Purity:Min. 95%Molecular weight:434.6 g/molRef: 3D-DMA15668
Discontinued productCL 387785
CAS:Irreversible inhibitor of EGFR receptor
Formula:C18H13BrN4OPurity:Min. 95%Molecular weight:381.23 g/mol24:0 PC
CAS:The fatty acid 24:0 PC is a polar, oxygenated lipid that is found in the outer layer of phosphatidylcholine. It is hydrated and has a high degree of polarity. The fatty acid 24:0 PC is also an important component of the cell membrane, where it helps maintain the integrity and fluidity of the bilayer. The fatty acid 24:0 PC plays a role in signal transduction by serving as a precursor to the synthesis of phosphatidylcholine-derived signal proteins such as sphingomyelin, which are involved in cellular proliferation and apoptosis. In addition, this fatty acid has been shown to have anticancer properties due to its ability to induce apoptosis in cancer cells in culture. This process is mediated by activation of caspase-3 and -9 through oxidative stress.
Formula:C56H112NO8PPurity:Min. 95%Molecular weight:958.46 g/molRef: 3D-RDA74211
Discontinued productPAK1 antibody
The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.
PDS5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDS5A antibody, catalog no. 70R-3908
Purity:Min. 95%XTP3TPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-1225
Purity:Min. 95%HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesKLF14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLF14 antibody, catalog no. 70R-8111
Purity:Min. 95%BECN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BECN1 antibody, catalog no. 70R-5935
Purity:Min. 95%AKR1C1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1C1 antibody, catalog no. 70R-10003
Purity:Min. 95%GALM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALM antibody, catalog no. 70R-3966
Purity:Min. 95%SMPD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD3 antibody, catalog no. 70R-7194
Purity:Min. 95%INHBA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INHBA antibody, catalog no. 70R-9280
Purity:Min. 95%ENTHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENTHD1 antibody, catalog no. 70R-4166
Purity:Min. 95%Galanin (2-29) (rat)
CAS:Galanin is a peptide that is used as a research tool to study ion channels, cell biology, and pharmacology. It binds to the galanin receptor and activates it. The gene encoding for this protein has been cloned and expressed in E. coli.
Formula:C144H210N42O39Purity:Min. 95%Molecular weight:3,153.5 g/molRef: 3D-RFA69611
Discontinued productKIAA1333 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1333 antibody, catalog no. 70R-3092
Purity:Min. 95%AKAP10 antibody
AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
Annexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
Thyroglobulin ELISA kit
ELISA kit for the detection of Thyroglobulin in the research laboratory
Purity:Min. 95%Fibronectin antibody
The Fibronectin antibody is a polyclonal antibody that specifically targets fibronectin, a glycoprotein involved in cell adhesion and migration. This antibody is widely used in life sciences research to study the role of fibronectin in various biological processes. It can be used to detect and quantify fibronectin levels in different samples, such as tissues or cell cultures. The Fibronectin antibody has also been shown to have potential therapeutic applications, particularly in cancer treatment. Studies have demonstrated its ability to inhibit tumor growth by blocking the interaction between fibronectin and its receptor on cancer cells. Additionally, this antibody has been used in combination with other drugs, such as sorafenib, to enhance their anti-cancer effects. Whether you are conducting research or developing new therapies, the Fibronectin antibody is an essential tool for studying fibronectin biology and its potential applications in various fields of medicine.
FOSB antibody
The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.
THC antibody (Gold Colloid)
THC antibody (Gold Colloid) was raised in mouse using tetrahydrocannabinol (THC) as the immunogen.Purity:Min. 95%UST Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UST antibody, catalog no. 70R-1825
Purity:Min. 95%RAE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4675
Purity:Min. 95%ALG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALG2 antibody, catalog no. 70R-2876
Purity:Min. 95%CACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5076
Purity:Min. 95%MPPED2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPPED2 antibody, catalog no. 70R-5251
Purity:Min. 95%CA 19-9 protein
CA 19-9 protein is a biomarker that is found in human serum. It can be detected using monoclonal antibodies and has various applications in research and diagnostics. The immobilization of CA 19-9 protein on an electrode surface allows for the development of cytotoxic or neutralizing assays, making it a valuable tool in studying immune responses. Additionally, CA 19-9 protein has antiangiogenic properties, which means it can inhibit the growth of new blood vessels. This makes it relevant in the field of cancer research, where angiogenesis plays a crucial role in tumor growth and metastasis. Furthermore, CA 19-9 protein can be used as a target for drug delivery systems or as a diagnostic marker for diseases such as pancreatic cancer. Its ability to induce lysis of certain cell types also makes it useful in studying cell death pathways and apoptotic processes involving caspase-9. Overall, CA 19-9 protein is an important molecule in the field of life sciencesPurity:Highly PurifiedAADAT antibody
AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI
Prrg3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Prrg3 antibody, catalog no. 70R-8831
Purity:Min. 95%
