Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,669 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(369 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
SNRPB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPB antibody, catalog no. 70R-4714
Purity:Min. 95%CSA antibody
The CSA antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the circumsporozoite protein (CSP), which is found on the surface of the malaria parasite. This antibody can be used to detect the presence of CSP in samples, making it a valuable tool for studying the biology and transmission of malaria.
Monkey Hemoglobin ELISA Kit
Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.
Purity:Min. 95%Protein C antibody
Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
PABPN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PABPN1 antibody, catalog no. 70R-4700
Purity:Min. 95%SLC22A15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A15 antibody, catalog no. 70R-7280
Purity:Min. 95%ZNF44 antibody
ZNF44 antibody was raised in mouse using recombinant Human Zinc Finger Protein 44 (Znf44)
LOC652618 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652618 antibody, catalog no. 70R-2982
Purity:Min. 95%LIN7C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LIN7C antibody, catalog no. 70R-2196
Purity:Min. 95%FAM116A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM116A antibody, catalog no. 70R-4205
Purity:Min. 95%EMP2 antibody
EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
HKR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HKR1 antibody, catalog no. 20R-1118
Purity:Min. 95%TLE4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TLE4 antibody, catalog no. 70R-7916
Purity:Min. 95%NR3C1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NR3C1 antibody, catalog no. 70R-5711
Purity:Min. 95%UBE2E3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E3 antibody, catalog no. 70R-2766
Purity:Min. 95%BACE antibody
The BACE antibody is a monoclonal antibody that has been specifically designed to target and inhibit the activity of beta-secretase (BACE1). This enzyme plays a crucial role in the production of amyloid-beta peptides, which are believed to be key contributors to the development of Alzheimer's disease. By binding to BACE1, the antibody effectively blocks its activity and prevents the formation of amyloid-beta peptides.
SPDP-dPEG®12-NHS Ester
CAS:SPDP-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C33H57N3O18Purity:Min. 95%Molecular weight:783.82 g/molTetraspanin 12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN12 antibody, catalog no. 70R-7189
Purity:Min. 95%Mouse IgE ELISA Kit
Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Desalkyl ebastine-d5
CAS:Please enquire for more information about Desalkyl ebastine-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C18H21NOPurity:Min. 95%Molecular weight:272.4 g/molRef: 3D-PXB42436
Discontinued productGabra5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gabra5 antibody, catalog no. 70R-7842
Purity:Min. 95%SMC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMC4 antibody, catalog no. 70R-5518
Purity:Min. 95%HKR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HKR1 antibody, catalog no. 70R-8457
Purity:Min. 95%TRIM37 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM37 antibody, catalog no. 70R-2244
Purity:Min. 95%E130307M08RIK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of E130307M08RIK antibody, catalog no. 20R-1150
Purity:Min. 95%CCS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCS antibody, catalog no. 70R-10222
Purity:Min. 95%UBE2I Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2I antibody, catalog no. 70R-1159
Purity:Min. 95%LOC391764 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC391764 antibody, catalog no. 70R-9050
Purity:Min. 95%SERPINB13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB13 antibody, catalog no. 70R-7068
Purity:Min. 95%DDX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX1 antibody, catalog no. 70R-4784
Purity:Min. 95%PNMA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA1 antibody, catalog no. 70R-2057
Purity:Min. 95%Bis-MAL-dPEG®11
CAS:Bis-MAL-dPEG®11 is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-MAL-dPEG®11 is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formula:C65H105F4N9O21S2Purity:Min. 95%Molecular weight:1,488.7 g/molRRM1 antibody
RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER
HBcAg antibody (Prediluted for IHC)
Rabbit polyclonal HBcAg antibody (Prediluted for IHC)Purity:Min. 95%Human IgG Fc protein
The Human IgG Fc protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes and has a wide range of applications. This protein is commonly used in research, diagnostics, and therapeutic development.
Purity:≥95% By Sds-PageHBXIP antibody
HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
RAB39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB39 antibody, catalog no. 70R-4499
Purity:Min. 95%Rat C3 ELISA Kit
Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Pcyt2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pcyt2 antibody, catalog no. 70R-9234
Purity:Min. 95%Human IgM ELISA Kit
Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%DNASE1L3 antibody
The DNASE1L3 antibody is a monoclonal antibody that specifically targets DNASE1L3, an enzyme involved in the degradation of DNA. This antibody has high affinity and specificity for DNASE1L3 and can be used as a diagnostic reagent in various research and clinical settings.
AK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AK1 antibody, catalog no. 70R-2397
Purity:Min. 95%GST antibody
The GST antibody is a highly reactive and cytotoxic monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the glutathione S-transferase (GST) protein, which plays a crucial role in detoxification processes within cells. The GST antibody can be used to detect and quantify GST levels in various samples, including human serum.Chymotrypsin-Like Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTRL antibody, catalog no. 70R-5436
Purity:Min. 95%Cobl-Like 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COBLL1 antibody, catalog no. 70R-3863
Purity:Min. 95%Dynactin 4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DCTN4 antibody, catalog no. 70R-3016
Purity:Min. 95%LOC100364462 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC100364462 antibody, catalog no. 70R-9134
Purity:Min. 95%Mouse IgG1 ELISA Kit
Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Affinity Purified anti-Dog IgE Antibody
This Affinity Purified Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as capture or detection antibody in various immunoassays. Please inquire for bulk pricing or custom conjugations.
Purity:Min. 95%UBASH3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBASH3A antibody, catalog no. 70R-2635
Purity:Min. 95%HSD17B14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSD17B14 antibody, catalog no. 70R-3811
Purity:Min. 95%TSHR antibody
TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.
A 331440 Dihydrochloride
CAS:A 331440 Dihydrochloride is a potent and selective NMDA receptor antagonist, which is a synthetic compound with notable binding affinity for modulating excitatory synaptic transmission. This product is derived from chemical synthesis, designed specifically for research applications involving neuronal signaling pathways. Its mode of action involves blocking the ion channels associated with NMDA receptors, thereby inhibiting the flow of calcium ions across the cell membrane.
Formula:C22H29Cl2N3OPurity:Min. 95%Molecular weight:422.4 g/molRef: 3D-ZRB74032
Discontinued productGPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%(R)-Apomorphine-d4 hydrochloride
CAS:Apomorphine is a non-selective dopamine receptor agonist that is used in the treatment of Parkinson's disease. Apomorphine, also known as (R)-apomorphine-d4 hydrochloride, is an activator of G-protein coupled receptors. It has been used to study ion channels and peptides, as well as to identify the binding site for various ligands. Apomorphine has been shown to inhibit the enzymatic activity of protein interactions that are important for cell proliferation and survival, including interactions between receptor tyrosine kinases and their substrates, adhesion proteins, and integrin receptors. This drug also has been shown to decrease the levels of beta amyloid plaques in Alzheimer's disease.
Formula:C17H18ClNO2Purity:Min. 95%Molecular weight:308.8 g/molSLC12A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A1 antibody, catalog no. 70R-3806
Purity:Min. 95%RAB5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5813
Purity:Min. 95%TIMP1 Heavy Tryptic Peptide Standard (4nmol)
A TIMP1 Heavy Tryptic Peptide Standard for protein identification and quantitation studies. TIMP1, also known as TIMP metallopeptidase inhibitor 1 is an inhibitor of matrix metalloproteinases, which are enzymes that break down the extracellular matrix. It has also been associated with cell proliferation promotion and may have a role in apoptosis.
Purity:Min. 95%PHF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHF6 antibody, catalog no. 70R-9074
Purity:Min. 95%KIF13B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF13B antibody, catalog no. 70R-5670
Purity:Min. 95%MGST1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGST1 antibody, catalog no. 70R-10041
Purity:Min. 95%WFDC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WFDC1 antibody, catalog no. 70R-3978
Purity:Min. 95%ASF1A protein (His tag)
1-204 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMAKV QVNNVVVLDN PSPFYNPFQF EITFECIEDL SEDLEWKIIY VGSAESEEYD QVLDSVLVGP VPAGRHMFVF QADAPNPGLI PDADAVGVTV VLITCTYRGQ EFIRVGYYVN NEYTETELRE NPPVKPDFSK LQRNILASNP RVTRFHINWE DNTEKLEDAE SSNPNLQSLL STDALPSASK GWSTSENSLN VMLESHMDCMRDH10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RDH10 antibody, catalog no. 70R-7462
Purity:Min. 95%SLC39A9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A9 antibody, catalog no. 70R-6753
Purity:Min. 95%Hyaluronan protein
Hyaluronan protein is a versatile compound that plays a crucial role in various biological processes. It is a major component of the extracellular matrix and is involved in cell proliferation, migration, and tissue repair. Hyaluronan protein interacts with collagen, fibronectin, alpha-fetoprotein, hemoglobin, interferon, and other proteins to form a protein complex that regulates cellular functions.Purity:Min. 95%Lysozyme antibody
The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.
RNH1 antibody
RNH1 antibody was raised in mouse using recombinant Ribonuclease inhibitor 1(RNH1) (7-461aa) purified from E. coli as the immunogen.FAN antibody
The FAN antibody is a highly versatile and effective tool used in various assays and hybridization techniques. It is an isothiocyanate-conjugated monoclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been widely used in research and diagnostic applications for the detection and quantification of AFP in biological samples.
SOX17 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques such as patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
WNT16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WNT16 antibody, catalog no. 70R-1909
Purity:Min. 95%
