Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of Sesn1 antibody, catalog no. 70R-9301

Kv1.3 channel blocker

MAL-dPEG®8-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®8-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A-278637 is a quinoline derivative that has been shown to be effective in treating acute decompensated heart failure. The mechanism of the drug is not fully understood, but it is thought to inhibit the opening of certain membrane channels in the bladder and detrusor muscle. A-278637 has also been shown to produce a significant increase in systolic pressure, which may be due to its ability to activate cardiac β 1 -adrenergic receptors.

Peptide sequence used to create CRB2005119.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC284009 antibody, catalog no. 70R-3217

Agonist of µ-opoid receptor

CPA2 antibody was raised in Rabbit using Human CPA2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Ece2 antibody, catalog no. 70R-8607

Custom research peptide; min purity 95%.

Mouse monoclonal CD11c antibody (allophycocyanin)

A synthetic peptide for use as a blocking control in assays to test for specificity of Htr3a antibody, catalog no. 70R-8076

MAL-dPEG®2-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.

The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.

The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.

dPEG®4 Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®4 Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.

Nav1.7 selective blocker

The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.

Rabbit polyclonal RBM8A antibody

Mouse monoclonal ELK3 antibody

IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Amino-dPEG®24-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®24-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf153 antibody, catalog no. 70R-3503

Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Xpo5 antibody, catalog no. 70R-8741

Pf 04671536 hydrochloride is a peptide that blocks the binding of the natural ligand to its receptor. It has been used in research as a tool to study protein interactions and antibody-antigen reactions. Pf 04671536 hydrochloride is also used as an inhibitor or activator of ion channels and receptors, which are important in pharmacology and cell biology. This peptide is highly purified and can be used for research in many different fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H1E antibody, catalog no. 70R-2889

WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR

Rabbit polyclonal RUSC1 antibody

CDC27 antibody was raised in Rabbit using Human CDC27 as the immunogen

Inhibitor of the binding of α1β1 integrin to collagen IV

The BAT antibody is a highly specific monoclonal antibody that is used in various assays to detect and measure the levels of interferon (IFN) in biological samples. This antibody has been extensively validated and proven to be highly sensitive and specific for IFN detection. It has been shown to neutralize the activity of IFN, making it an essential tool for studying the role of IFN in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT1 antibody, catalog no. 70R-2469

A synthetic peptide for use as a blocking control in assays to test for specificity of MINK1 antibody, catalog no. 70R-7944

Thiol-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Mouse monoclonal CBWD1 antibody

NSC348884 is a novel anti-cancer drug that is an inhibitor of RNA polymerase. It has been shown to inhibit cellular transformation and viability in human leukemia HL-60 cells and prostate cancer cells, as well as inducing apoptosis. The mechanism of action of NSC348884 may be mediated through the induction of reactive oxygen species (ROS), activation of caspases, and modulation of signal transduction pathways. NSC348884 has also been shown to induce a variety of transcriptional effects on tumor cells, including upregulation or downregulation of genes involved in cell cycle regulation and apoptosis. This drug is also efficacious against brain tumors with malignant characteristics and breast cancer cells that are resistant to monoclonal antibody therapy.

t-boc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Custom research peptide; min purity 95%.

Rabbit polyclonal RDH13 antibody

The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.

The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZRSR2 antibody, catalog no. 70R-1377

The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.

A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf18 antibody, catalog no. 70R-6877

Rabbit polyclonal CDK1 antibody (Tyr15)

Hydroxy-dPEG®6-t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®6-t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

NVP-BVU972 is a small molecule inhibitor of the tyrosine kinase activity of the epidermal growth factor receptor. It has been shown to inhibit the growth of cancer cells in vitro and in vivo. NVP-BVU972 binds to the ATP binding site of the kinase domain and inhibits protein synthesis by preventing phosphorylation of downstream substrates. This drug also has a pharmacokinetic profile that is not affected by renal or hepatic dysfunction. NVP-BVU972 is currently being evaluated as a predictive biomarker for cancer treatment response.

Drebrin antibody was raised in guinea pig using a synthetic human peptide corresponding to residues 324-343 of drebrin coupled to KLH as the immunogen.

The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ccdc90b antibody, catalog no. 70R-8824

A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP antibody, catalog no. 70R-6235

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDH7 antibody, catalog no. 70R-6178

Affinity purified Rabbit polyclonal DUSP26 antibody

RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6151

Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.

Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.

NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP3 antibody, catalog no. 70R-3561

Region of FGF basic protein corresponding to amino acids PALPEDGGGA FPPGHFKDPK RLYCKNGGFF LRIHPDGRVD GVREKSDPHV KLQLQAEERG VVSIKGVCAN RYLAMKEDGR LLASKCVTEE CFFFERLESN NYNTYRSRKY SSWYVALKRT GQYKLGSKTG PGQKAILFLP MSAKS.

(2S)-Arimoclomol maleate is a ligand that is used in research as a cell biology tool. It is an inhibitor of potassium channels, which are ion channels that activate the release of neurotransmitters. It has been shown to be a high-quality reagent and is used to study protein interactions, receptor activation, and pharmacology. Additionally, this compound can be used as a research tool in the field of cell biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of RARRES3 antibody, catalog no. 70R-1725

Affinity purified Rabbit polyclonal ABH1 antibody

Rabbit polyclonal GRM7 antibody (Ser862)

Affinity purified Rabbit polyclonal PDE4B antibody

CCNH antibody was raised in Rabbit using Human CCNH as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ARFGAP1 antibody, catalog no. 70R-9476

Affinity purified Rabbit polyclonal CMAS antibody

EVX1 antibody was raised in rabbit using the N terminal of EVX1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A2 antibody, catalog no. 70R-6535

A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP7 antibody, catalog no. 70R-5313

The Citrate Synthetase Antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to citrate synthetase, an enzyme involved in the Krebs cycle. By binding to this enzyme, the antibody allows for the detection and analysis of citrate synthetase levels in various biological samples.

Rat monoclonal RAE1g antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA13 antibody, catalog no. 70R-10162

Rabbit polyclonal HIST1H4E antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of WDSUB1 antibody, catalog no. 70R-2815

Bis-dPEG®13-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®13-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

Affinity purified Rabbit polyclonal BXDC1 antibody

MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK

A synthetic peptide for use as a blocking control in assays to test for specificity of EPSTI1 antibody, catalog no. 70R-7096

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCN6 antibody, catalog no. 70R-1521

Rabbit polyclonal PLCL2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of F11 antibody, catalog no. 70R-10231

The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.

HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA

Lorazepam 3 Conjugate for use in immunoassays

The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PSD3 antibody, catalog no. 70R-3151

A synthetic peptide for use as a blocking control in assays to test for specificity of YIPF2 antibody, catalog no. 70R-8830