Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,576 products)
- By Biological Target(100,660 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
HDAC2 antibody
The HDAC2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects hepatocyte growth factor (HGF), fibronectin, collagen, and other important proteins. This antibody is widely used in research laboratories for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It can be used to study the expression and localization of HGF and other proteins in different tissues and cell types. The HDAC2 antibody is also commonly used in drug discovery and development to evaluate the effect of potential inhibitors on protein complexes involved in growth factor signaling pathways. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of cell biology, molecular biology, and drug development.
ME1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ME1 antibody, catalog no. 70R-2940
Purity:Min. 95%DDX3X Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX3X antibody, catalog no. 70R-4688
Purity:Min. 95%AMC
CAS:AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END>
Formula:C10H9NO2Purity:Min. 95%Molecular weight:175.18 g/molPTRH2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTRH2 antibody, catalog no. 70R-1785
Purity:Min. 95%RASGEF1A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RASGEF1A antibody, catalog no. 70R-5738
Purity:Min. 95%Human IL-6 ELISA Kit
Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.
Purity:Min. 95%CHIA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHIA antibody, catalog no. 70R-5920
Purity:Min. 95%OCT3 antibody
The OCT3 antibody is a monoclonal antibody that specifically targets and binds to the organic cation transporter 3 (OCT3). This antibody has been extensively studied and shown to have a high affinity for OCT3, making it a valuable tool for research in the field of life sciences.
Human IL1 β ELISA kit
ELISA kit for the detection of IL1 beta in the research laboratory
Purity:Min. 95%RAB18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB18 antibody, catalog no. 70R-5796
Purity:Min. 95%ZNF474 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF474 antibody, catalog no. 70R-7871
Purity:Min. 95%TAC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAC1 antibody, catalog no. 70R-9810
Purity:Min. 95%GNAO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNAO1 antibody, catalog no. 70R-5233
Purity:Min. 95%RAD18 antibody
The RAD18 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine receptor RAD18, which is involved in the immune response. This antibody can be used for various applications, such as immunoassays and neutralizing experiments. The RAD18 antibody is a chimeric protein composed of human immunoglobulin and can effectively bind to RAD18 glycoprotein. It has been shown to activate interferon and steroid signaling pathways, making it a valuable tool for studying immune responses and related diseases. With its high specificity and potency, the RAD18 antibody is an essential component in any research involving chemokines and their interactions with the immune system.
TOP2A antibody
The TOP2A antibody is a polyclonal antibody that targets the TOP2A protein. This protein is involved in various cellular processes, including DNA replication and repair. It plays a crucial role in regulating cell growth and division.
EHD4 antibody
EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA
Goat anti Human IgG (H + L) (biotin)
Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.
Purity:Min. 95%SNRPA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPA1 antibody, catalog no. 70R-1350
Purity:Min. 95%RGS13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-2712
Purity:Min. 95%Thymosin, beta 10 (human, rat)
Thymosin, beta 10 (human, rat) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Vamp1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9793
Purity:Min. 95%SLAMF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLAMF6 antibody, catalog no. 70R-7224
Purity:Min. 95%OLR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OLR1 antibody, catalog no. 70R-1739
Purity:Min. 95%FOXRED1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FOXRED1 antibody, catalog no. 70R-4893
Purity:Min. 95%FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
BSCL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BSCL2 antibody, catalog no. 70R-8856
Purity:Min. 95%EIF1AX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF1AX antibody, catalog no. 70R-5014
Purity:Min. 95%CTSG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTSG antibody, catalog no. 70R-10247
Purity:Min. 95%Acp2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Acp2 antibody, catalog no. 70R-8619
Purity:Min. 95%SPACA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPACA1 antibody, catalog no. 70R-8848
Purity:Min. 95%DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit
Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%ANGPTL4 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
Purity:Min. 95%Goat anti Human IgG (H + L) (FITC)
Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.
Purity:Min. 95%C13ORF28 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf28 antibody, catalog no. 70R-3516
Purity:Min. 95%CPS1 antibody
CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
RNASEL antibody
RNASEL antibody was raised in rabbit using the C terminal of RNASEL as the immunogenPurity:Min. 95%DYSF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DYSF antibody, catalog no. 70R-6848
Purity:Min. 95%SURF6 antibody
SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA
PNMT antibody
The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.
ALAD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALAD antibody, catalog no. 70R-3444
Purity:Min. 95%CDH1 antibody
CDH1 antibody was raised in Mouse using a purified recombinant fragment of human CDH1 expressed in E. coli as the immunogen.1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde
CAS:1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde is a ligand that is used as a research tool for studying protein interactions and receptor activation. It can be used to study ion channels, cell biology, and pharmacology. 1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde has been shown to inhibit the binding of an antibody to its antigen in an ELISA assay. This inhibitor is also a high purity reagent with CAS number 956716-93-1.Formula:C15H12N2O3SPurity:Min. 95%Molecular weight:300.3 g/molRef: 3D-GNB71693
Discontinued productAmphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.Symplekin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SYMPK antibody, catalog no. 70R-6031
Purity:Min. 95%MtSSB antibody
The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.
NRIP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NRIP3 antibody, catalog no. 70R-8956
Purity:Min. 95%SIN3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIN3B antibody, catalog no. 70R-8938
Purity:Min. 95%MCM7 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
STRAP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STRAP antibody, catalog no. 70R-2067
Purity:Min. 95%SLITRK6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLITRK6 antibody, catalog no. 70R-7284
Purity:Min. 95%PHEX antibody
The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.
Melanoma-overexpressed antigen 1 (36-44)
Peptide Melanoma-overexpressed antigen 1 (36-44) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ZIM3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZIM3 antibody, catalog no. 70R-8107
Purity:Min. 95%Rab23 antibody
Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen
Purity:Min. 95%USP12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of USP12 antibody, catalog no. 70R-3798
Purity:Min. 95%S100 antibody
The S100 antibody is a highly specialized monoclonal antibody that is reactive and cytotoxic. It is widely used in Life Sciences research for its neutralizing properties. This antibody specifically targets collagen, a crucial glycoprotein involved in various cellular processes such as growth factor signaling and cell adhesion. The S100 antibody has shown promising results in studies involving mesenchymal stem cells, where it has been found to have an immobilization effect on these cells. Additionally, this antibody can also be used in combination with polyclonal antibodies to target specific proteins, such as hepatocyte growth factor. Its unique mechanism of action involves inhibiting the activity of subtilisin/kexin type enzymes, further enhancing its therapeutic potential.
ADSL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADSL antibody, catalog no. 70R-9952
Purity:Min. 95%CACNB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB1 antibody, catalog no. 70R-5067
Purity:Min. 95%DCX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DCX antibody, catalog no. 70R-5901
Purity:Min. 95%TRIM58 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM58 antibody, catalog no. 70R-9574
Purity:Min. 95%C2ORF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-2461
Purity:Min. 95%Parathyroid Hormone (Human, 39-68)
CAS:Amino acids 39-68 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.
Formula:C139H234N46O46Purity:Min. 95%Molecular weight:3,285.6 g/molESRRG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-1940
Purity:Min. 95%
![1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FGNB71693.webp&w=3840&q=75)
