Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
INPP5B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5B antibody, catalog no. 70R-2472
Purity:Min. 95%SIGLEC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6185
Purity:Min. 95%MEF2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MEF2B antibody, catalog no. 20R-1125
Purity:Min. 95%GTL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GTL3 antibody, catalog no. 70R-8024
Purity:Min. 95%TRUB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRUB2 antibody, catalog no. 70R-1245
Purity:Min. 95%LRRC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC6 antibody, catalog no. 70R-2626
Purity:Min. 95%SRRM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRRM4 antibody, catalog no. 70R-10054
Purity:Min. 95%FXYD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FXYD5 antibody, catalog no. 70R-6056
Purity:Min. 95%ATG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG3 antibody, catalog no. 70R-9663
Purity:Min. 95%FICD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FICD antibody, catalog no. 70R-5702
Purity:Min. 95%UNC45A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-2703
Purity:Min. 95%Hamster CHO β 2-Microglobulin (B2M) ELISA Kit
Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.
Purity:Min. 95%H-SIRLPGCPRGVNPVV-OH
Peptide H-SIRLPGCPRGVNPVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pannexin 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PANX1 antibody, catalog no. 70R-6579
Purity:Min. 95%ABCC1 antibody
The ABCC1 antibody is a polyclonal antibody that specifically targets the ABCC1 protein. This protein plays a crucial role in multidrug resistance and is involved in the transport of various substances across cell membranes. The ABCC1 antibody has been shown to neutralize the activity of ABCC1, making it an effective tool for studying the function of this protein.
Gastric mucin
CAS:Mucin is majorly composed of carbohydrate units, the monomer of mucin being about 640 kDa.
Purity:Min. 95%Molecular weight:1,000 g/molASPH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASPH antibody, catalog no. 70R-7074
Purity:Min. 95%FMO3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FMO3 antibody, catalog no. 70R-6581
Purity:Min. 95%KCNK6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK6 antibody, catalog no. 70R-5203
Purity:Min. 95%IL11 protein
Region of IL11 protein corresponding to amino acids MPGPPPGPPR VSPDPRAELD STVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LLSYLRHVQW LRRAGGSSLK TLEPELGTLQ ARLDRLLRRL QLLMSRLALP QPPPDPPAPP LAPPSSAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL.Purity:Min. 95%VU 0155041
CAS:VU 0155041 is a low potency neuroprotective agent that has been shown to have antioxidative properties. It has been shown in animal studies to protect against oxidative injury by reducing the formation of reactive oxygen species and lipid peroxidation, which are responsible for cell damage. VU 0155041 also inhibits glutamate-induced toxicity in rat brain slices. In addition, VU 0155041 has been shown to have pharmacological effects on neurotransmission and transcriptional regulation. The drug has not yet been tested on humans, but it is thought that this drug may be useful as a treatment for stroke or head trauma; it may also be useful as a treatment for Parkinson's disease or epilepsy.
Formula:C14H15Cl2NO3Purity:Min. 95%Molecular weight:316.18 g/molRef: 3D-TTB75742
Discontinued productMMP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP3 antibody, catalog no. 70R-8526
Purity:Min. 95%PDIA4 antibody
The PDIA4 antibody is a highly specialized product in the field of Life Sciences. It possesses unique characteristics that make it a valuable tool for various applications. This monoclonal antibody has been developed to target and neutralize the activity of PDIA4, a protein kinase involved in important cellular processes.
KIF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-8012
Purity:Min. 95%H-LPFFSNVTWF-OH
Peptide H-LPFFSNVTWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MICA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MICA antibody, catalog no. 70R-1705
Purity:Min. 95%STK11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STK11 antibody, catalog no. 70R-9641
Purity:Min. 95%H-SFNR-OH
Peptide H-SFNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TRPM3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DCI antibody, catalog no. 70R-2524Purity:Min. 95%DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
H-VLIQFLQK-OH
Peptide H-VLIQFLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ISCA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ISCA2 antibody, catalog no. 70R-2471
Purity:Min. 95%Ac-ASGVAVSDGVIK-OH
Peptide Ac-ASGVAVSDGVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ZG16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZG16 antibody, catalog no. 70R-5441
Purity:Min. 95%SHPRH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SHPRH antibody, catalog no. 70R-4679
Purity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%IDH1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IDH1 antibody, catalog no. 70R-2495
Purity:Min. 95%Ac-SGRGKQGGKAR-OH
Peptide Ac-SGRGKQGGKAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
RGS4 antibody
The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.
KIF2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF2B antibody, catalog no. 70R-5604
Purity:Min. 95%PCAF antibody
The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.
MYB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MYB antibody, catalog no. 70R-8269
Purity:Min. 95%SLC25A22 antibody
SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
alpha Synuclein 160 protein
MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTKPurity:>95% By Sds-PageH-AYSLFSYNTQGR-OH
Peptide H-AYSLFSYNTQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PAPSS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PAPSS2 antibody, catalog no. 70R-2875
Purity:Min. 95%H-KLYDPLYHPSM-OH
Peptide H-KLYDPLYHPSM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
KT109
CAS:Controlled ProductKT109 is a fatty acid that has been shown to be detected in the blood of heterozygous mice. It is also found in wild-type mice, but not at levels as high as those found in heterozygous mice. KT109 is associated with degenerative diseases such as Alzheimer's and Parkinson's disease, which may be due to its role in regulating the production of endocannabinoids. Endocannabinoids are neurotransmitters that act on cannabinoid receptors and have been shown to play a role in the treatment of these degenerative diseases.
Formula:C27H26N4OPurity:Min. 95%Molecular weight:422.52 g/molRef: 3D-CGC61255
Discontinued productPYY protein
PYY protein is a growth factor that plays a crucial role in human serum. It interacts with actin filaments, which are essential for cellular structure and movement. PYY protein can be used in various Life Sciences applications, including the study of proteins and antigens. It can be utilized as a target for monoclonal antibodies or anti-dnp antibodies. Additionally, PYY protein has been used in research involving other growth factors like epidermal growth factor and anti-her2 antibody. Its colloidal nature makes it suitable for use in electrode-based assays. With its diverse applications and interactions, PYY protein is a valuable tool for researchers in the field of Life Sciences.
Purity:Min. 95%H-MESSAKRKMDPDNPD-OH
Peptide H-MESSAKRKMDPDNPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ASPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASPA antibody, catalog no. 70R-3333
Purity:Min. 95%H-SLDDYNHLV-OH
Peptide H-SLDDYNHLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ApoC1 protein
The ApoC1 protein is a colony-stimulating factor that plays a crucial role in various biological processes. It has been extensively studied and widely used in the field of Life Sciences. The protein can be used in particle reactions, such as with MDA-MB-231 cells, to study its effects on cell growth and function. Monoclonal antibodies specific to ApoC1 are available for research purposes, allowing for targeted detection and analysis. Additionally, ApoC1 has been found to have autoantibodies present in certain conditions, making it a potential biomarker for disease diagnosis. Its activation by inositol and its interactions with other proteins further contribute to its significance in cellular processes. Overall, the ApoC1 protein offers valuable insights into various areas of research and holds promise for future discoveries in the field of Proteins and Antigens.Purity:Min. 95%NR2F1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NR2F1 antibody, catalog no. 70R-1936
Purity:Min. 95%Occludin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OCLN antibody, catalog no. 70R-1721
Purity:Min. 95%Rat Triiodothyronine ELISA kit
ELISA Kit for detection of Triiodothyronine in the research laboratory
Purity:Min. 95%XAF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XAF1 antibody, catalog no. 70R-3726
Purity:Min. 95%TOM20 antibody
The TOM20 antibody is a monoclonal antibody that has a wide range of applications in the field of Life Sciences. It specifically targets TOM20, a protein involved in mitochondrial import and sorting. This antibody can be used for various research purposes, including the detection and quantification of TOM20 in different biological samples.
Cited4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Cited4 antibody, catalog no. 70R-8201
Purity:Min. 95%Biotin-dPEG®11-Oxyamine HCl
Biotin-dPEG®11-Oxyamine HCl is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-Oxyamine HCl is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C34H67CIN4O14SPurity:Min. 95%Molecular weight:823.43 g/molKCNK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-5210
Purity:Min. 95%dsDNA IgM ELISA kit
ELISA kit for the detection of dsDNA IgM in the research laboratory
Purity:Min. 95%Glp-1 receptor agonist 2
CAS:Glp-1 receptor agonist 2 is a research tool that is used as an inhibitor. It can be used for cell biology, pharmacology, and ion channels. Glp-1 receptor agonist 2 has been shown to inhibit ligand binding to the glucagon receptor and has been shown to activate the G protein-coupled receptor. This drug has also been found to inhibit the activity of protein phosphatase 1 in cells. Glp-1 receptor agonist 2 is a high purity product that can be used for many applications in life science research.
Formula:C30H31ClFN5O4Purity:Min. 95%Molecular weight:580 g/molRef: 3D-FPD19764
Discontinued productTRIM23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM23 antibody, catalog no. 70R-7894
Purity:Min. 95%Ebastine-d5
CAS:Ebastine-d5 is a selective inhibitor of the histamine H1 receptor. It binds to the ligand binding site of the H1 receptor and blocks the activity of this receptor. This drug has been shown to be an effective treatment for allergic rhinitis, chronic urticaria, and other allergic conditions. Ebastine-d5 is used in research as a tool to study protein interactions and receptor function.
Formula:C32H34D5NO2Purity:Min. 95%Molecular weight:474.69 g/molRef: 3D-RYB95313
Discontinued productH-AEDTAVYYCAK-OH
Peptide H-AEDTAVYYCAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PRSS21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS21 antibody, catalog no. 70R-9241
Purity:Min. 95%KCNAB2 antibody
KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL
Hdac3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Hdac3 antibody, catalog no. 70R-8546
Purity:Min. 95%Rasfonin
CAS:Rasfonin is a natural product that was found in an extract of the plant Etoac. It has been shown to inhibit the growth of pancreatic cancer cells and have anticancer activity. Rasfonin is structurally similar to the anticancer drug temozolomide, but it does not have any known toxicity. Rasfonin binds to DNA and inhibits transcriptional activation by the nuclear factor-kappa B (NF-κB) pathway. It also induces autophagy, which is important for maintaining cellular homeostasis, preventing tumor formation, and inducing apoptosis. This compound has been shown to inhibit proliferation of normal as well as cancerous cells in vitro and in vivo.
Formula:C25H38O6Purity:Min. 95%Molecular weight:434.6 g/molRef: 3D-DMA15668
Discontinued productCollagen Type II antibody
Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.
SOCS3 antibody
The SOCS3 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets annexin A2, a protein involved in various cellular processes such as erythropoietin signaling, low-density lipoprotein endocytosis, and epidermal growth factor receptor trafficking. This antibody is commonly used in research studies to investigate the role of annexin A2 in different biological pathways.
FDXR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FDXR antibody, catalog no. 70R-2532
Purity:Min. 95%BRSV antibody
BRSV antibody was raised in rabbit using residues 483-488 [FPSDEFC] of the 63 kDa RSV and BRSV F protein as the immunogen.Purity:Min. 95%AP2A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AP2A2 antibody, catalog no. 70R-9954
Purity:Min. 95%App Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of App antibody, catalog no. 70R-7939
Purity:Min. 95%
