Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Bibx 1382 dihydrochloride
CAS:Bibx 1382 dihydrochloride is a liposome-encapsulated drug that binds to the extracellular domain of ICAM-1, which is a protein found on the surface of cancer cells. Bibx 1382 dihydrochloride slows the growth of cancer cells by binding to calmodulin, an intracellular protein, and inhibiting it from activating phosphatase 2A. This inhibition leads to reduced activation of protein kinase C and decreased production of cyclic AMP. Bibx 1382 dihydrochloride also inhibits the activity of tumor necrosis factor alpha (TNF-α), which is an inflammatory cytokine that causes inflammation and cell death in cancer cells. Bibx 1382 dihydrochloride has been shown to be effective against cancer cell lines in vitro and in vivo with a microfluidic device that encapsulates the drug.
Formula:C18H21Cl3FN7Purity:Min. 95%Molecular weight:460.8 g/molRef: 3D-RYB92018
Discontinued productKCNB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNB1 antibody, catalog no. 70R-5114
Purity:Min. 95%MIPOL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MIPOL1 antibody, catalog no. 70R-4071
Purity:Min. 95%EVE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of eve antibody, catalog no. 70R-2549
Purity:Min. 95%SPSB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10124
Purity:Min. 95%PPCDC antibody
PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
ARHGAP20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP20 antibody, catalog no. 70R-9503
Purity:Min. 95%Zfp275 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp275 antibody, catalog no. 70R-8773
Purity:Min. 95%TUFM antibody
TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
SRRM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRRM4 antibody, catalog no. 70R-10054
Purity:Min. 95%Copine IV Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE4 antibody, catalog no. 70R-2844
Purity:Min. 95%MST1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MST1 antibody, catalog no. 70R-5281
Purity:Min. 95%ER-000444793
CAS:ER-000444793 is a drug that belongs to the group of mitochondrial membrane permeabilizations. It has been shown to have an effect on the mitochondrial membrane potential, which can lead to cell death. ER-000444793 has been shown to be effective in cardiac tissue, as well as other tissues such as liver and kidney. The mechanism of action is not fully understood, but it is thought to be mediated by the mitochondrial membrane permeabilization and subsequent release of proapoptotic factors.
Formula:C23H18N2O2Purity:Min. 95%Molecular weight:354.4 g/molRef: 3D-SGB95774
Discontinued productHSPE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPE1 antibody, catalog no. 70R-4219
Purity:Min. 95%SLC6A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A2 antibody, catalog no. 70R-7065
Purity:Min. 95%Gamma Tubulin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUBG2 antibody, catalog no. 70R-4513
Purity:Min. 95%SMC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMC4 antibody, catalog no. 70R-5499
Purity:Min. 95%VAMP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VAMP7 antibody, catalog no. 70R-8715
Purity:Min. 95%SIGLEC9 antibody
The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.
GLRX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLRX3 antibody, catalog no. 70R-4390
Purity:Min. 95%Zfp472 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp472 antibody, catalog no. 70R-8410
Purity:Min. 95%MVP antibody
The MVP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to dinitrophenyl (DNP) antigens, making it a valuable tool for studying immune responses. This antibody has been shown to have neutralizing effects on interferon and endothelial growth factors, inhibiting their activity. Additionally, the MVP antibody has been found to induce lysis of target cells in the presence of complement or human serum. Its ability to inhibit caspase-9 activation suggests a potential role in apoptosis regulation. Furthermore, this monoclonal antibody has been shown to immobilize β-catenin, an important protein involved in cell adhesion and signaling pathways. These unique characteristics make the MVP antibody an essential tool for researchers studying antiangiogenic and growth factor-related processes in various biological systems.
Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
GPT Antibody
The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.Purity:Min. 95%MCEE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MCEE antibody, catalog no. 70R-10039
Purity:Min. 95%VTI1A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VTI1A antibody, catalog no. 70R-6971
Purity:Min. 95%Ciita antibody
Ciita antibody was raised in rabbit using CIITA peptide corresponding to a region near the N-terminus of the human protein conjugated to KLH as the immunogen.
Purity:Min. 95%Complement C3 protein
Complement C3 protein is a test compound that plays a crucial role in the immune system. It is involved in various processes such as inflammation, opsonization, and immune complex clearance. Complement C3 protein interacts with IFN-gamma and is found to have intraocular effects. This protein is commonly used in research and diagnostic applications in the field of Life Sciences. It has been shown to exhibit neutralizing properties against autoantibodies and can be used for studying interferon and chemokine signaling pathways. Additionally, complement C3 protein has been implicated in endothelial growth factor regulation, making it an important target for therapeutic interventions related to angiogenesis. Its high viscosity allows for easy handling during experiments.Purity:Min. 95%Sec31a Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307
Purity:Min. 95%SLC25A45 antibody
SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.
TIMP1 protein
Region of TIMP1 protein corresponding to amino acids CTCVPPHPQT AFCNSDLVIR AKFVGTPEVN QTTLYQRYEI KMTKMYKGFQ ALGDAADIRF VYTPAMESVC GYFHRSHNRS EEFLIAGKLQ DGLLHITTCS FVAPWNSLSL AQRRGFTKTY TVGCEECTVF PCLSIPCKLQ SGTHCLWTDQ LLQGSEKGFQ SRHLACLPRE PGLCTWQSLR SQIA.Purity:Min. 95%CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
GTF2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GTF2B antibody, catalog no. 70R-9578
Purity:Min. 95%CACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5096
Purity:Min. 95%FOXO6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FOXO6 antibody, catalog no. 20R-1176
Purity:Min. 95%IL24 antibody
The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.
ZNF572 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF572 antibody, catalog no. 70R-8129
Purity:Min. 95%GABBR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GABBR2 antibody, catalog no. 70R-10243
Purity:Min. 95%KCTD18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD18 antibody, catalog no. 70R-1504
Purity:Min. 95%ZNF251 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF251 antibody, catalog no. 70R-8176
Purity:Min. 95%KLF4 antibody
The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.
LRRC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC6 antibody, catalog no. 70R-2626
Purity:Min. 95%Ier3ip1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Ier3ip1 antibody, catalog no. 70R-8674
Purity:Min. 95%CtBP1 antibody
The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.
C17ORF81 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf81 antibody, catalog no. 70R-3946
Rimtuzalcap
CAS:Rimtuzalcap is a monoclonal antibody, which is derived from a hybridoma technology involving the fusion of specific immune cells. It operates through the highly specific binding to a targeted antigen, thereby modulating immune responses or interfering with signaling pathways. This precision in action enhances its efficacy and minimizes off-target effects compared to broader immunomodulatory agents.
Formula:C18H24F2N6OPurity:Min. 95%Molecular weight:378.42 g/molRef: 3D-BR184195
Discontinued productGuf1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Guf1 antibody, catalog no. 70R-9515
Purity:Min. 95%CELSR3 antibody
CELSR3 antibody is a powerful antiviral agent that targets the lipoprotein lipase, a key enzyme involved in viral replication. This monoclonal antibody acts as a medicament by neutralizing the growth factor required for viral proliferation. The colloidal nature of this antibody allows for efficient targeting and binding to specific viral particles. Additionally, CELSR3 antibody exhibits high specificity towards the CD20 antigen, making it an effective therapeutic option for diseases characterized by abnormal CD20 expression. Its unique glycosylation pattern and fatty acid modifications enhance its stability and prolong its half-life in circulation. With its potent antiviral properties and precise targeting capabilities, CELSR3 antibody is a promising tool in the field of life sciences for combating viral infections.
ATE1 antibody
ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
STAU1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STAU1 antibody, catalog no. 70R-4824
Purity:Min. 95%UST antibody
UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
FKBP1a /FKBP12 protein (His tag)
1-108 amino acids: MGSSHHHHHH SSGLVPRGSH MGVQVETISP GDGRTFPKRG QTCVVHYTGM LEDGKKFDSS RDRNKPFKFM LGKQEVIRGW EEGVAQMSVG QRAKLTISPD YAYGATGHPG IIPPHATLVF DVELLKLEPurity:Min. 95%IL16 protein (His tag)
502-631 amino acids: MGSSHHHHHH SSGLVPRGSH MPDLNSSTDS AASASAASDV SVESTAEATV CTVTLEKMSA GLGFSLEGGK GSLHGDKPLT INRIFKGAAS EQSETVQPGD EILQLGGTAM QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKETTAAGDS
Purity:Min. 95%IL18BP antibody
IL18BP antibody was raised in goat using highly pure recombinant murine IL-18BP as the immunogen.Purity:Min. 95%GAA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAA antibody, catalog no. 70R-7147
Purity:Min. 95%VSIG4 antibody
VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
Mouse IgG Control
Mouse IgG Control is a highly reliable and versatile monoclonal antibody that is widely used in various research applications. It serves as an important control for experiments involving mucin, polyclonal antibodies, protein, ferritin, and other activated monoclonal antibodies. This control antibody allows researchers to accurately assess the specificity and efficacy of their experimental procedures.IL1b antibody
IL1b antibody was raised in rabbit using recombinant human IL-1b as the immunogen.
Purity:Min. 95%FECH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FECH antibody, catalog no. 70R-2666
Purity:Min. 95%EXOC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC4 antibody, catalog no. 70R-2859
Purity:Min. 95%IRX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX6 antibody, catalog no. 70R-8751
Purity:Min. 95%Salmonella antibody
Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.HAT1 protein (His tag)
20-341 amino acids: MGSSHHHHHH SSGLVPRGSH MKKLAEYKCN TNTAIELKLV RFPEDLENDI RTFFPEYTHQ LFGDDETAFG YKGLKILLYY IAGSLSTMFR VEYASKVDEN FDCVEADDVE GKIRQIIPPG FCTNTNDFLS LLEKEVDFKP FGTLLHTYSV LSPTGGENFT FQIYKADMTC RGFREYHERL QTFLMWFIET ASFIDVDDER WHYFLVFEKY NKDGATLFAT VGYMTVYNYY VYPDKTRPRV SQMLILTPFQ GQGHGAQLLE TVHRYYTEFP TVLDITAEDP SKSYVKLRDF VLVKLCQDLP CFSREKLMQG FNEDMAIEAQ QKFKINKQHA RRVYEILRLL VTDPurity:Min. 95%TRUB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRUB2 antibody, catalog no. 70R-1245
Purity:Min. 95%LHR antibody
The LHR antibody is a high-quality polyclonal antibody that specifically targets the luteinizing hormone receptor (LHR). It is widely used in various research fields, particularly in the life sciences. This antibody is highly specific and exhibits strong binding affinity to LHR, making it an excellent tool for studying the role of LHR in different biological processes.
Goat anti Rabbit IgG (Texas Red)
Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%Junctophilin 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of JPH3 antibody, catalog no. 70R-6706
Purity:Min. 95%AQP2 antibody
The AQP2 antibody is an immobilized monoclonal antibody that specifically targets the AQP2 antigen. It is commonly used in Life Sciences research to study amyloid plaque formation and to investigate the role of AQP2 in various physiological processes. The AQP2 antibody can also be used in combination with other antibodies, such as anti-CD20 antibodies, for immunotherapy purposes. This antibody is highly specific and has been extensively validated for its efficacy and reliability. Researchers can use the AQP2 antibody in experiments involving techniques like electrode-based assays or as inhibitors to study the effects of blocking AQP2 function. Its versatility makes it a valuable tool for scientists working in various fields, including molecular biology, biochemistry, and immunology.
POLI Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLI antibody, catalog no. 70R-4581
Purity:Min. 95%CEA protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%TMC8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMC8 antibody, catalog no. 70R-4056
Purity:Min. 95%SNRK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRK antibody, catalog no. 70R-2565
Purity:Min. 95%
