Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM156A antibody, catalog no. 70R-4820

A synthetic peptide for use as a blocking control in assays to test for specificity of SFTPB antibody, catalog no. 70R-5411

A synthetic peptide for use as a blocking control in assays to test for specificity of GALK1 antibody, catalog no. 70R-10394

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC17 antibody, catalog no. 70R-4635

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5605

Rabbit polyclonal PPP3CB antibody

XRCC3 antibody was raised in rabbit using the C terminal of XRCC3 as the immunogen

The beta 2 Microglobulin protein is a versatile molecule with a wide range of characteristics and applications. It has been shown to have toxic effects on human serum, affecting various biological processes. Additionally, it plays a role in the production of colony-stimulating factors, which are essential for the growth and differentiation of cells.

Rabbit polyclonal RBMX2 antibody

Affinity purified Rabbit polyclonal hnRNP C1/C2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB11 antibody, catalog no. 70R-7353

A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL9 antibody, catalog no. 70R-2833

Rabbit polyclonal REEP6 antibody

Peptide H-VMTPRTLIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

NFE2L1 antibody was raised in Rabbit using Human NFE2L1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP19 antibody, catalog no. 70R-4137

A synthetic peptide for use as a blocking control in assays to test for specificity of CDC2 antibody, catalog no. 70R-5615

PDE7A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf2 antibody, catalog no. 70R-8987

IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Chst11 antibody, catalog no. 70R-8685

A synthetic peptide for use as a blocking control in assays to test for specificity of GPT2 antibody, catalog no. 70R-2968

AGTRAP antibody was raised in Rabbit using Human AGTRAP as the immunogen

ELISA kit for the detection of EPO in the research laboratory

DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6AP1 antibody, catalog no. 70R-4520

The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.

GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Rabbit polyclonal Calreticulin antibody (HRP)

Human Thyroglobulin is a glycosylated, polypeptide chain having a total molecular mass of 660 kDa.  For solubility use phosphate buffer, pH>7.0 containing 0.15M NaCl.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACCN1 antibody, catalog no. 70R-5101

A synthetic peptide for use as a blocking control in assays to test for specificity of CCS antibody, catalog no. 70R-10221

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC342293 antibody, catalog no. 70R-1790

A synthetic peptide for use as a blocking control in assays to test for specificity of CSTF3 antibody, catalog no. 70R-4882

FKBP7 antibody was raised in Rabbit using Human FKBP7 as the immunogen

Purified Dog IgG (Fab'2) FITC conjugate

A synthetic peptide for use as a blocking control in assays to test for specificity of Wdr92 antibody, catalog no. 70R-9191

A synthetic peptide for use as a blocking control in assays to test for specificity of RIT1 antibody, catalog no. 70R-10367

BRUNOL6 antibody was raised in Rabbit using Human BRUNOL6 as the immunogen

Rabbit polyclonal CSTF1 antibody

UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

1-(2,4-Dimethylphenyl)-4-(3-methylpiperidin-1-yl)-1H-pyrazolo[3,4-d]pyrimidine (also known as PDMP) is a peptide that has been shown to inhibit the interaction between proteins. It has been used as a research tool and an inhibitor in studies of receptor binding and ion channels. The high purity of PDMP makes it an excellent candidate for use in antibody production.

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPT1 antibody, catalog no. 70R-2759

Purified Sheep IgG (Fab)

The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.

Rabbit polyclonal LDHA antibody (biotin)

±-Nitrostilbene is a chemical compound that belongs to the group of phenylpropanoids. It has been shown to be a potent inhibitor of the ion channels TRPV1 and TRPA1, which are involved in pain signalling pathways. ±-Nitrostilbene also shows high affinity for certain receptors, such as the cannabinoid receptor CB2 and the opioid receptor KOR. This compound has been used for research in pharmacology and cell biology.

ER-000444793 is a drug that belongs to the group of mitochondrial membrane permeabilizations. It has been shown to have an effect on the mitochondrial membrane potential, which can lead to cell death. ER-000444793 has been shown to be effective in cardiac tissue, as well as other tissues such as liver and kidney. The mechanism of action is not fully understood, but it is thought to be mediated by the mitochondrial membrane permeabilization and subsequent release of proapoptotic factors.

The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.

Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.

AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END>

Rabbit polyclonal CCL5 antibody (HRP)

PC58538 is a peptide that inhibits the binding of Ligands to Receptors. It has been shown to be an inhibitor at the GABA receptor and can inhibit the activation of Protein kinase C. PC58538 is used as a research tool for studying protein interactions, cell biology, and pharmacology. This peptide is also used in antibody production and has been shown to have high purity.

Affinity purified Rabbit polyclonal TOM1L1 antibody

NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.

The TP63 protein is a trifunctional protein that plays a crucial role in various biological processes. It is involved in the regulation of cell proliferation, differentiation, and apoptosis. TP63 has been extensively studied using techniques such as polymerase chain reaction (PCR) and molecular docking.

A synthetic peptide for use as a blocking control in assays to test for specificity of PA2G4 antibody, catalog no. 70R-8718

The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.

A synthetic peptide for use as a blocking control in assays to test for specificity of CRLF2 antibody, catalog no. 70R-4480

A synthetic peptide for use as a blocking control in assays to test for specificity of PSCD4 antibody, catalog no. 70R-4408

FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

A synthetic peptide for use as a blocking control in assays to test for specificity of ORAI1 antibody, catalog no. 70R-6426

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC54 antibody, catalog no. 70R-3303

FBXO7 antibody was raised in Rabbit using Human FBXO7 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SESN2 antibody, catalog no. 70R-10131

A synthetic peptide for use as a blocking control in assays to test for specificity of Pa2g4 antibody, catalog no. 70R-9556

A synthetic peptide for use as a blocking control in assays to test for specificity of PCGF1 antibody, catalog no. 70R-4454

A synthetic peptide for use as a blocking control in assays to test for specificity of ACO2 antibody, catalog no. 70R-2446

A synthetic peptide for use as a blocking control in assays to test for specificity of CSGlcA-T antibody, catalog no. 70R-2825

MATK antibody was raised in Rabbit using Human MATK as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of UPF1 antibody, catalog no. 70R-4618

A synthetic peptide for use as a blocking control in assays to test for specificity of BCO2 antibody, catalog no. 70R-10117

The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.

FOXE3 antibody was raised in Rabbit using Human FOXE3 as the immunogen

Luteinizing hormone-releasing hormone (LH-RH), also known as Gonadotropin-Releasing Hormone (GnRH), stimulates the pituitary gland’s production and secretion of luteinizing hormone and follicle-stimulating hormone. LHRH is a decapeptide and is itself secreted by the hypothalamus. It is crucial for human reproduction and is heavily involved in the regulation of ovulation, sexual development and the onset of puberty.
When secreted, GNRH binds to the G-protein coupled receptor, gonadotropin-releasing hormone receptor (GNRHR) located on pituitary gonadotrophic cells in the anterior pituitary.
Medically, the understanding of GnRH is paramount, due to its involvement in the pathogensis of central hypogonadism. Any obstructions to its function in the reproductive system can result in the development of human pathologically conditions. It is important to note that analogs of GnRH can be used in pharmacology, in the treatment of gynaecological diseases, through blocking the secretion of estrogen secretion from the ovary. Additional GNRH analogs can be used to treat ovarian cancer, hormone-dependent cancers, endometriosis and modality in infertility. Therefore this product is a useful research tool.

GSK J5 is a lysine-specific histone methyltransferase inhibitor that is used to treat cancer and autoimmune diseases. GSK J5 inhibits the activity of histone methyltransferases, which are enzymes that transfer methyl groups to specific lysine residues in the chromatin. This results in transcriptional repression, which can be reversed by removing the drug. GSK J5 has been shown to cause cell cycle arrest and apoptosis in primary cells and inhibit endothelial cell proliferation in vitro. In vivo treatment with GSK J5 has been shown to reduce insulin resistance, thereby improving insulin sensitivity and decreasing tumour size in animal models of diabetes.
GSK J5 is a potent inhibitor of HDACs (histone deacetylase) which are enzymes that remove acetyl groups from histones, leading to transcriptional activation. GSK J5 also downregulates the expression of growth factors such as VEGF (vascular endothelial growth factor) and PD

Human IgG Fc is an immunoglobulin that plays a crucial role in the immune system. It is responsible for neutralizing pathogens and promoting immune responses. Human IgG Fc has been extensively studied for its various functions, including its ability to bind to insulin antibodies and cholinergic receptors. It also interacts with other molecules such as collagen, parathyroid hormone-related protein, and fibronectin, playing a role in cell adhesion and signaling pathways.

TRIM23 antibody was raised in rabbit using the C terminal of TRIM23 as the immunogen

The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD4 antibody, catalog no. 70R-5091

Affinity purified Rabbit polyclonal IL12 Receptor beta 2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PAXIP1 antibody, catalog no. 70R-9091

A synthetic peptide for use as a blocking control in assays to test for specificity of MRTO4 antibody, catalog no. 70R-2933

Mouse monoclonal 200 kDa Neurofilament antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-5026

Rabbit polyclonal RAB3C antibody

Peptide H-WQTGTNPLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of DGCR6L antibody, catalog no. 70R-10201

Omega-Conotoxin GVIA is a peptide toxin that binds to the nicotinic acetylcholine receptor (nAChR) and blocks its function. It has been shown to be an inhibitor of voltage-gated potassium channels, which are responsible for regulating the electrical activity in cells. Omega-conotoxin GVIA is purified with a high degree of purity and has been shown to have no significant cross-reactivity with other nAChR subtypes. This toxin can be used as a research tool to study nAChR physiology or as an antibody to target this receptor in cell biology experiments.

KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Homomazindol is a benzodiazepine that binds to the benzodiazepine receptor, which is found in the central nervous system. It has been shown to have strong affinity for the striatal region of the rat brain, and it can be used as an in vitro assay for ligands. In vivo assays have also shown that homomazindol binds to dopamine receptors, and it has been suggested that this may be related to its anticonvulsant effects. Homomazindol's chemical structure is similar to cocaine, and it has been shown to have similar effects on dopamine release in rat striatal membranes. This drug can exist as two tautomers: one with a hydroxyl group and one without. In addition, homomazindol hydrochloride (HOM) is related to methoxyhomomazindol (MOM), which has been shown to bind more tightly than HOM does.

The HAVCR1 antibody is a polyclonal antibody that targets the protein known as HAVCR1. This antibody plays a crucial role in various biological processes, including caspase-9 activation, nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway, β-catenin stabilization, and p38 mitogen-activated protein kinase (MAPK) activation.