Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,679 products)
- By Biological Target(100,185 products)
- By Pharmacological Effects(6,848 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(355 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130274 products of "Biochemicals and Reagents"
CCL5 antibody
The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.
PRKAA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRKAA1 antibody, catalog no. 70R-5932
Purity:Min. 95%Mouse Serum Albumin antibody
Mouse serum albumin antibody was raised in rabbit using mouse serum as the immunogen.Purity:Min. 95%Glucoiberin
CAS:Glucoiberin is a natural compound that has been shown to possess anticancer properties. It works by inhibiting the activity of certain proteins and enzymes that are involved in tumor growth and development. Glucoiberin has been found to be a potent inhibitor of chitinase, which is an enzyme that is often overexpressed in cancer cells. Additionally, it has been shown to induce apoptosis (programmed cell death) in human cancer cells, making it a promising candidate for cancer treatment. Glucoiberin is commonly found in Chinese medicinal herbs and can be detected in human urine after ingestion. It may also have potential as a kinase inhibitor and as an alternative to heparin therapy.
Formula:C11H21NO10S3Purity:Min. 95%Molecular weight:423.5 g/molRef: 3D-AAA55488
Discontinued productGastrin antibody
Gastrin antibody was raised in rabbit using human gastrin 17 conjugated to BSA as the immunogen.Purity:Min. 95%ACO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACO1 antibody, catalog no. 70R-4994
Purity:Min. 95%EXOC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC1 antibody, catalog no. 70R-9538
Purity:Min. 95%RBM47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM47 antibody, catalog no. 70R-4958
Purity:Min. 95%KIAA0999 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0999 antibody, catalog no. 70R-9253
Purity:Min. 95%CAV1 antibody
The CAV1 antibody is a highly specialized medicament that is used in various research and diagnostic applications. It specifically targets caveolin-1, a protein that plays a crucial role in cell signaling and membrane trafficking. The CAV1 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.
TLR8 antibody
The TLR8 antibody is a specific antibody used in Life Sciences to neutralize the activity of Toll-like receptor 8 (TLR8). TLR8 plays a crucial role in the immune response by recognizing and binding to various pathogen-associated molecular patterns. This antibody has been shown to inhibit the activation of TLR8 by blocking its interaction with ligands such as single-stranded RNA. By doing so, it prevents downstream signaling pathways that lead to the production of inflammatory cytokines like TNF-α and chemokines. Additionally, this antibody has been found to modulate collagen synthesis, fibronectin expression, and epidermal growth factor (EGF)-like growth factors. Its versatility makes it an essential tool for research in immunology and related fields.
DsbE protein
26-185 amino acids: MRNAEGDDPT NLESALIGKP VPKFRLESLD NPGQFYQADV LTQGKPVLLN VWATWCPTCR AEHQYLNQLS AQGIRVVGMN YKDDRQKAIS WLKELGNPYA LSLFDGDGML GLDLGVYGAP ETFLIDGNGI IRYRHAGDLN PRVWEEEIKP LWEKYSKEAA Q
Purity:Min. 95%Prothrombin fragment 1 antibody
Prothrombin fragment 1 antibody was raised in sheep using human Prothrombin purified from plasma as the immunogen.
C6ORF182 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf182 antibody, catalog no. 70R-3111
Purity:Min. 95%PMVK antibody
The PMVK antibody is a highly specialized antibody that plays a crucial role in the immune response. It is activated by interferon-gamma (IFN-gamma) and exhibits cytotoxic activity against target cells. This antibody specifically targets tyrosine residues on growth factors, leading to their neutralization and inhibition of cell proliferation. Additionally, the PMVK antibody has been shown to bind to annexin proteins, which are involved in apoptotic processes. This monoclonal antibody is produced using cutting-edge technology and is highly specific for its target antigen. It has been widely used in life sciences research, including studies on adenine metabolism and the development of antiviral therapies.
CD44 antibody
The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.
MAGEA9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA9 antibody, catalog no. 70R-8268
Purity:Min. 95%TMPRSS4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp technique, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its unique mechanisms of action and potent properties, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is
GJA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJA1 antibody, catalog no. 70R-6087Purity:Min. 95%GJB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJB2 antibody, catalog no. 70R-1685
Purity:Min. 95%C1QTNF4 antibody
C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
Purity:Min. 95%CASP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CASP3 antibody, catalog no. 70R-9649
Purity:Min. 95%GFRA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10340
Purity:Min. 95%TRIM59 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM59 antibody, catalog no. 70R-6350
Purity:Min. 95%MI-1
CAS:MI-1 is a DNA polymerase that is derived from the mitochondria of Saccharomyces cerevisiae. It has been shown to have significant interactions with a number of drugs and other compounds, including those involved in energy metabolism, insect resistance, and cardiovascular health. MI-1 has been shown to be stable in complex with nucleotides, which may be due to its ability to form stable complexes with dNTPs. MI-1 is also involved in the replication of mitochondrial DNA and myocardial infarct size reduction.
Formula:C19H25N5S2Purity:Min. 95%Molecular weight:387.6 g/molRef: 3D-ISA31107
Discontinued productSTAT2 antibody
The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.
Resistin antibody
Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.Purity:Min. 95%GPR18 antibody
The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.
RRM2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RRM2 antibody, catalog no. 70R-5609
Purity:Min. 95%FDFT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FDFT1 antibody, catalog no. 70R-1132
Purity:Min. 95%FH antibody
FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.
Necap1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Necap1 antibody, catalog no. 70R-9317
Purity:Min. 95%Sheep Red Blood Cells
Sheep Red Blood Cells (SRBC) are widely used in veterinary applications for various assays and tests. These cells contain fatty acids, anti-HBs antibodies, and other components that make them suitable for different diagnostic purposes. SRBC can be used in immunohistochemistry to detect specific antigens or monoclonal antibodies. They are also commonly used in experiments to measure the activity of cyclase-activating proteins or the production of interferon-gamma (IFN-gamma). Additionally, SRBC have low density, which makes them ideal for certain experimental procedures. Whether you need them for research or clinical applications, Sheep Red Blood Cells provide a reliable and versatile tool for a wide range of veterinary applications.Purity:Min. 95%DDX24 antibody
The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.
Sonic hedgehog protein
Sonic Hedgehog Protein is a multifunctional protein that plays a crucial role in various cellular processes. It has been shown to interact with interferon and tyrosine, indicating its involvement in immune response modulation. Additionally, Sonic Hedgehog Protein has been found to inhibit the activity of human serum inhibitory factor, suggesting its potential therapeutic use in autoimmune diseases associated with antiphospholipid antibodies. In the field of Life Sciences, this protein is widely studied for its ability to regulate dopamine levels and act as an antigen for the development of antibodies. Researchers often utilize recombinant Sonic Hedgehog Protein to investigate its functions and interactions with other proteins. Furthermore, it has been implicated in the regulation of leukemia inhibitory factor and the production of autoantibodies. Its amide structure makes it suitable for electrode applications in various scientific experiments.
Purity:Min. 95%EIF4E2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E2 antibody, catalog no. 70R-9622
Purity:Min. 95%RAD51L3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD51L3 antibody, catalog no. 70R-10335
Purity:Min. 95%CHIA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHIA antibody, catalog no. 70R-5921
Purity:Min. 95%PAQR6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PAQR6 antibody, catalog no. 70R-6329
Purity:Min. 95%Carbonyl Reductase 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CBR1 antibody, catalog no. 70R-1026
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Alk Phos)
Goat anti-rabbit IgG (H + L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.Purity:Min. 95%SEPP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPP1 antibody, catalog no. 70R-2714
Purity:Min. 95%TM9SF4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TM9SF4 antibody, catalog no. 70R-6872Purity:Min. 95%ACPT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACPT antibody, catalog no. 70R-7296
Purity:Min. 95%BC37295_3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171
Purity:Min. 95%Annexin A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA5 antibody, catalog no. 70R-1669
Purity:Min. 95%GABABR2 antibody
GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.
Purity:Min. 95%Dok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Molecular weight:1,524.72 g/molBudralazine
CAS:Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.
Formula:C14H16N4Purity:Min. 95%Molecular weight:240.3 g/molRef: 3D-LBA79879
Discontinued product[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Molecular weight:2,167.52 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Molecular weight:2,570 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C45H47FN6O14Purity:Min. 95%Molecular weight:914.89 g/molTariquidar
CAS:Potent P-glycoprotein (P-gp) inhibitor
Formula:C38H38N4O6Purity:Min. 97 Area-%Color and Shape:PowderMolecular weight:646.73 g/molBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Molecular weight:3,552.17 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molRef: 3D-FA110203
Discontinued productAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formula:C88H139N25O26Molecular weight:1,963.24 g/molR-Avanafil
CAS:Please enquire for more information about R-Avanafil including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H26ClN7O3Purity:Min. 95%Molecular weight:483.9 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formula:C104H154N26O31SMolecular weight:2,296.61 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SMolecular weight:2,638.15 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Molecular weight:5,971.67 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Molecular weight:2,596 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molACY-775
CAS:ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.
Formula:C17H19FN4O2Purity:Min. 95%Molecular weight:330.36 g/molRef: 3D-BA168231
Discontinued productSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SMolecular weight:1,347.66 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molRef: 3D-FS109491
Discontinued product[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formula:C67H110N20O17Molecular weight:1,467.75 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-BC183139
Discontinued productGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Molecular weight:2,206.53 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C36H39F3N6O13SPurity:Min. 95%Molecular weight:852.79 g/molRef: 3D-FA110597
Discontinued productCalmodulin-Dependent Protein Kinase II (290-309)
CAS:Calmodulin-dependent protein kinase II (CAMKII) is a calcium/calmodulin-dependent enzyme that plays an important role in the regulation of cardiac contractility. CAMKII is activated by the binding of beta-adrenergic and other hormones to their receptors on the plasma membrane, leading to a change in the membrane potential. CAMKII then phosphorylates myofibrils, which leads to an increase in cardiac contractility. In liver cells, CAMKII activation leads to an increase in contractility and perfusion through increased ethylene production.
Formula:C103H185N31O24SPurity:Min. 95%Molecular weight:2,273.83 g/molRef: 3D-FC110422
Discontinued productTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purity:Min. 95%Molecular weight:1,765.06 g/molRef: 3D-FT109022
Discontinued product(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/molRef: 3D-FD108769
Discontinued product
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
