Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Angiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formula:C40H52N10O13Molecular weight:880.92 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Molecular weight:1,383.68 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Molecular weight:4,190.77 g/molBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formula:C62H101N17O19Molecular weight:1,388.58 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Molecular weight:2,311.60 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Molecular weight:344.41 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Molecular weight:1,171.33 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Molecular weight:4,017.55 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SMolecular weight:2,638.15 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Molecular weight:937.08 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Molecular weight:1,524.72 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Molecular weight:1,715.91 g/molVilaprisan
CAS:Vilaprisan is a synthetic peptide that can act as an inhibitor or activator of protein interactions. It binds to the ligand-binding site of receptor proteins and blocks ion channels, which leads to inhibition of the flow of ions across cell membranes. Vilaprisan has been shown to be a research tool for studying the workings of ion channels and antibodies in cells. Vilaprisan is also used as a reagent to identify and characterize antibodies that are specific for certain receptors, including those with high purity.
Formula:C27H29F5O4SPurity:Min. 95%Color and Shape:PowderMolecular weight:544.60 g/molDesmopressin
CAS:Controlled ProductDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069.22 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SMolecular weight:1,269.31 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SMolecular weight:698.9 g/molMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H246N41O40P3Molecular weight:3,320.78 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C45H47FN6O14Purity:Min. 95%Molecular weight:914.89 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formula:C82H122N22O25SMolecular weight:1,848.08 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Molecular weight:2,573.99 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formula:C52H84N14O21Molecular weight:1,241.33 g/molIGF-II (33-40)
CAS:This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.Formula:C38H74N20O12Purity:Min. 95%Molecular weight:1,003.12 g/molRef: 3D-FI110021
Discontinued productHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formula:C46H75N9O11S2Molecular weight:994.28 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Molecular weight:1,406.62 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C74H128N16O18Molecular weight:1,529.95 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C54H79N13O17Molecular weight:1,182.31 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formula:C68H113N19O19Molecular weight:1,500.77 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formula:C47H85N14O13SMolecular weight:1,087.35 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Molecular weight:5,102.84 g/molICG 001
CAS:Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin
Formula:C33H32N4O4Purity:Min. 95%Molecular weight:548.63 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formula:C59H97N17O19Molecular weight:1,348.53 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formula:C75H114N24O19Molecular weight:1,655.89 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SMolecular weight:3,849.30 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Sarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Molecular weight:2,596 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SMolecular weight:1,347.66 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formula:C88H139N25O26Molecular weight:1,963.24 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formula:C164H278N58O45S4Molecular weight:3,910.64 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formula:C97H160N26O32Molecular weight:2,202.51 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SMolecular weight:2,392.86 g/mol(Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt
CAS:Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C388H588N106O114S4Purity:Min. 95%Molecular weight:8,689.73 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formula:C145H238N48O38S2Molecular weight:3,325.86 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SMolecular weight:3,103.54 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formula:C28H36N6O6Molecular weight:552.64 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formula:C119H204N34O32SMolecular weight:2,655.23 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Formula:C157H261N49O43S6Molecular weight:3,715.47 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SMolecular weight:1,286.53 g/molEC 23
CAS:EC 23 is a synthetic retinoid that belongs to the class of chemical compounds called retinoids. Retinoids are natural or synthetic substances that have a high affinity for binding to receptors on the cell surface and activating them. EC 23 has been shown to induce bacterial enzymes that break down long-chain fatty acids, which are toxic to bacteria. It also has been shown to be potent inducers of cellular differentiation in certain animal models, including the mouse embryo eye. EC 23 binds with high affinity to bacterial enzyme and inhibits its activity. It also has been shown to inhibit the growth of certain types of cancer cells in culture, but not others.
Formula:C23H24O2Purity:Min. 95%Molecular weight:332.44 g/molAmyloid beta-Protein (1-11) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C56H76N16O22Purity:Min. 95%Molecular weight:1,325.3 g/molRef: 3D-FA108822
Discontinued productAlpha 1 Antichymotrypsin protein
Alpha 1 Antichymotrypsin protein is a basic protein that plays a crucial role in the regulation of proteolytic activity. It acts as an inhibitor of chymotrypsin and other serine proteases, preventing excessive proteolysis in various physiological processes. This protein is known to interact with acidic proteins such as histidine-rich glycoprotein and annexin A2, forming complexes that modulate their functions. Additionally, Alpha 1 Antichymotrypsin protein has been shown to regulate the activity of growth factors like epidermal growth factor, contributing to cell proliferation and differentiation. In the field of Life Sciences, this protein is widely used in research studies involving low-density lipoproteins, collagen synthesis, fatty acid metabolism, and annexin biology. Its native form ensures optimal bioactivity and stability for reliable experimental results. Choose Alpha 1 Antichymotrypsin protein for your research needs and unlock new insights into cellular processes and diseasePurity:Min. 95%Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purity:Min. 95%Molecular weight:604.65 g/molCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Molecular weight:930.04 g/molAZD5069
CAS:AZD5069 is a small molecule that serves as a potent and selective antagonist of the CXC chemokine receptor 2 (CXCR2). It is derived from synthetic pharmaceutical research efforts aimed at targeting key signaling pathways in inflammatory diseases. This compound functions by inhibiting the CXCR2 receptor, which plays a critical role in the recruitment and activation of neutrophils, a type of white blood cell involved in inflammation and immune responses.
Formula:C18H22F2N4O5S2Purity:Min. 95%Molecular weight:476.52 g/molRef: 3D-DKB38584
Discontinued productP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molPF 05175157
CAS:PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.
Formula:C23H27N5O2Purity:Min. 95%Molecular weight:405.49 g/molRef: 3D-BCC21447
Discontinued productRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Formula:C80H124N24O25SMolecular weight:1,854.08 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Molecular weight:727.79 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SMolecular weight:2,314.59 g/molBoc-Phe-Gly-Gly-OH
CAS:Boc-Phe-Gly-Gly-OH is a peptide that can be used in the synthesis of peptides. It has reactive moieties and is a carboxylic acid with an aromatic amino group. Boc-Phe-Gly-Gly-OH is a site-specific catalyst that reacts with hydroxyl groups on the ligation side to form amide bonds. The catalytic mechanism of this compound involves a nucleophilic attack by the carbonyl oxygen atom on the electrophilic carbon atom, forming an intermediate iminium ion. This intermediate then tautomerizes to give the desired product and CO2.
Formula:C18H25N3O6Purity:Min. 95%Molecular weight:379.41 g/molRef: 3D-FB111238
Discontinued productFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Molecular weight:359.43 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formula:C103H156N32O25Molecular weight:2,242.59 g/molH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O6C2F3HO2Purity:Min. 95%Molecular weight:348.23 g/molRef: 3D-FT108183
Discontinued productBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Formula:C171H254N4O16Molecular weight:3,870.52 g/molDenosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued product[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Molecular weight:1,345.62 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SMolecular weight:729.86 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formula:C194H318N62O62SMolecular weight:4,543.14 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Molecular weight:1,009.19 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SMolecular weight:3,710.26 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111727
Discontinued productHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formula:C52H96N20O16Molecular weight:1,257.47 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formula:C93H136N22O27Molecular weight:1,994.25 g/molDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formula:C27H48N8O7S3Purity:Min 95%Molecular weight:692.92 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Molecular weight:2,631.93 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SMolecular weight:6,220.84 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Molecular weight:760.94 g/mol[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Molecular weight:1,541.73 g/molInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Molecular weight:894.04 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Molecular weight:1,622.77 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C190H288N54O57Molecular weight:4,240.64 g/molKUNB31
CAS:KUNB31 is a synthetic enzyme inhibitor, which is an engineered compound designed to interfere with the activity of specific enzymes in various biochemical pathways. This product is synthesized through a series of complex chemical reactions, ensuring high specificity and activity against target enzymes. Its mode of action involves binding to the active sites of enzymes, thereby preventing substrates from interacting and altering enzymatic activity.
Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.4 g/molRef: 3D-VND26380
Discontinued productBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Molecular weight:2,325.82 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Molecular weight:1,667.90 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formula:C35H56N8O9SMolecular weight:765 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Molecular weight:3,969.50 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SMolecular weight:1,522.81 g/mol
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
