Biochemicals and Reagents

The SFTPB antibody is a specific antibody used in Life Sciences research. It is a monoclonal antibody that specifically binds to surfactant protein B (SFTPB), which plays a crucial role in lung function. This antibody can be used for various applications, including the detection and quantification of SFTPB in samples such as human serum or tissue lysates. Additionally, it has been shown to have serum albumin-binding properties, making it useful for studies involving serum albumin or related proteins. The SFTPB antibody can also be used in combination with other antibodies, such as anti-thyroglobulin antibodies or phospholipid scramblase antibodies, to investigate specific pathways or protein interactions. Its high affinity and specificity make it an essential tool for researchers studying lung biology or related fields.

Mouse monoclonal CBWD1 antibody

Purified native Human Lys-Plasminogen protein

Diphtheria toxin antibody was raised in mouse using diphtheria toxin and anatoxin as the immunogen.

PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

AFP 464 is an activating agent that binds to the molecular target, which is thought to be growth rate. AFP 464 has been shown to increase the activation of cancer cells and cause a change in their phenotype. It also has anti-tumor effects on kidney cancer cells and other carcinoma cells. AFP 464 is potently activated by spontaneous sequestration or postulated mechanisms. Treatment with AFP 464 has been shown to produce a decrease in tumor size and weight as well as an increase in life span for mice with kidney cancer.

The AURKA antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to a class of inhibitors that target specific proteins involved in cellular processes. This monoclonal antibody has been extensively tested and proven to be highly cytotoxic against various cancer cell lines. In addition, it has shown promising results in inhibiting the growth factor signaling pathway and blocking the activity of leukemia inhibitory factor. The AURKA antibody is derived from human serum and exhibits excellent specificity and affinity for its target protein. Its colloidal nature allows for easy handling and application in various experimental setups. Researchers can rely on this monoclonal antibody to accurately detect and quantify the presence of hormone peptides, autoantibodies, and other biomolecules of interest.

Rabbit polyclonal YES1 antibody

Purified Rabbit polyclonal PIK3R1 antibody

E.coli-derived,-18.7 kDa-Recombinant-Murine IL-10

ATP-dependent inhibitor of mTOR1/2

Miclxin is a peptide that is used as a research tool in the field of pharmacology and cell biology. Miclxin binds to ion channels and inhibits their function, which may be due to its ability to inhibit ligand binding. Miclxin has been shown to act as an activator or inhibitor of ion channels. It has been shown to have high purity and is available for purchase at a CAS number of 2494198-61-5.

Erso is a medicinal compound that has been developed to target cancer cells by disrupting the cell cycle and inducing apoptosis. It works by inhibiting the activity of kinases, which are enzymes that play a key role in regulating cell growth and division. Erso has shown promising results in preclinical studies, demonstrating its ability to inhibit tumor growth and induce cancer cell death in both Chinese hamster ovary cells and human cancer cell lines. The protein inhibitor also shows potential for use as a diagnostic tool, as it can be detected in urine samples of patients with certain types of cancer. With its targeted approach to fighting cancer, Erso is poised to become an important tool in the fight against this devastating disease.

TNF-± Antagonist III is a drug that is used to inhibit the production of TNF-α. It has been shown to regulate transcriptional activity in cells and to inhibit the growth of cancer cells. TNF-± Antagonist III has been observed to decrease the M2 phenotype, which may be due to its ability to activate ATP levels in macrophages. This drug also inhibits kidney fibrosis by reducing pro-inflammatory factors, such as tumor necrosis factor-α (TNF-α) and fatty acids. The drug also has effects on abdominal surgery, as it reduces inflammation following this type of procedure. TNF-± Antagonist III is used in fat tissue and adipose tissue, where it reduces the number of pro-inflammatory factors produced by macrophages.

Rac 1-Nitroso-2-methylindoline is a potent anticancer agent that has been shown to induce apoptosis in cancer cells. It works by inhibiting protein kinase activity, which plays a critical role in cancer cell proliferation and survival. This compound is an analog of a Chinese medicinal herb and has been found to be effective against various types of tumors in human studies. Rac 1-Nitroso-2-methylindoline acts as a cell cycle inhibitor, preventing the growth and division of cancer cells. It is also being investigated as a potential urine biomarker for early detection of certain types of cancers. With its promising properties, rac 1-Nitroso-2-methylindoline holds great potential as a powerful weapon in the fight against cancer.

Alpertine is a pharmaceutical preparation that is used to diagnose and treat depression. It is an n-oxide of serotonin and a fatty acid ester. Alpertine has been shown to have antidepressant effects in animal models, but it does not affect the central nervous system (CNS). Alpertine's mechanism of action may be related to its effects on gamma-aminobutyric acid (GABA) and its ability to inhibit the uptake of fatty acids by muscle cells.

Please enquire for more information about 1-Methyl-4-phenyl-3-(1H-pyrrol-1-yl)-1H-pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page

TOK-8801 is a thiazole-2-carboxamide compound that has immunomodulatory, immunopharmacological, and antigen properties. TOK-8801 induces a delayed type hypersensitivity response in mice and inhibits the proliferation of human T cells by inhibiting the binding of CD28 to B7.1 or B7.2. It also has been shown to suppress the growth of T cells by inhibiting IL-2 production and enhance the function of macrophages by inducing IL-12 secretion. TOK-8801 is being investigated as a potential treatment for autoimmune diseases such as systemic lupus erythematosus, rheumatoid arthritis, and multiple sclerosis.

Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.