Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,865 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Hepatitis C Virus protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Studies have demonstrated its high efficacy using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%GALNT14 antibody
GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYAPurity:Min. 95%CDK4 antibody
Cyclin Dependent Kinase 4 antibody was raised in mouse using human recombinant full-length cdk4 polypeptide as the immunogen.PRMT2 antibody
PRMT2 antibody was raised in mouse using recombinant Human Protein Arginine Methyltransferase 2GJB4 antibody
GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
FAM161A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM161A antibody, catalog no. 70R-10072Purity:Min. 95%ETV1 antibody
ETV1 antibody was raised in Mouse using a purified recombinant fragment of ETV1(aa1-191) expressed in E. coli as the immunogen.KLHL2 antibody
KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
SNIP1 antibody
The SNIP1 antibody is a polyclonal antibody used in the field of life sciences. It specifically targets the methyl transferase SNIP1, which plays a crucial role in various cellular processes. This antibody is widely used in research studies to investigate the function and regulation of SNIP1.SLC37A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC37A3 antibody, catalog no. 70R-6591Purity:Min. 95%FOP antibody
FOP antibody was raised in Rat using Mouse Friend of Prmt1 C-terminus and GST fusion protein as the immunogen.MDH2 antibody
MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKHuman RBC antibody (FITC)
Human RBC antibody (FITC) was raised in rabbit using human erythrocytes as the immunogen.Adenovirus protein
Adenovirus protein is a highly versatile and activated protein that plays a crucial role in Life Sciences. It has been shown to activate the production of tumor necrosis factor-alpha (TNF-α), which is an important cytokine involved in immune responses. This Native Protein & Antigen is colloidal in nature, making it easy to work with in various research applications.Purity:Min. 95%CAP1 antibody
CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWRPurity:Min. 95%RUNX1 antibody
The RUNX1 antibody is a highly specialized antibody used in Life Sciences research. It targets the RUNX1 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. The antibody specifically binds to the β-catenin domain of the RUNX1 protein, inhibiting its interaction with other proteins and altering downstream signaling pathways.ACVR1 antibody
ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPPurity:Min. 95%GGPS1 antibody
GGPS1 antibody was raised using the C terminal of GGPS1 corresponding to a region with amino acids LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENENNT1 protein
Region of NNT1 protein corresponding to amino acids MLNRTGDPGP GPSIQKTYDL TRYLEHQLRS LAGTYLNYLG PPFNEPDFNP PRLGAETLPR ATVDLEVWRS LNDKLRLTQN YEAYSHLLCY LRGLNRQAAT AELRRSLAHF CTSLQGLLGS IAGVMAALGY PLPQPLPGTE PTWTPGPAHS DFLQKMDDFW LLKELQTWLW RSAKDFNRLK KKMQPPAAAV TLHLGAHGF.Purity:Min. 95%NFkB p65 antibody
The NFkB p65 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to the NFkB p65 protein, which plays a crucial role in various cellular processes. This antibody is widely used in research and diagnostic applications to study the function and regulation of NFkB signaling pathways.HORMAD2 antibody
HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII
DROSHA antibody
The DROSHA antibody is a high-quality monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein DROSHA, which plays a crucial role in the processing of microRNAs. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and flow cytometry.
Neurturin protein
Region of Neurturin protein corresponding to amino acids ARLGARPCGL RELEVRVSEL GLGYASDETV LFRYCAGACE AAARVYDLGL RRLRQRRRLR RERVRAQPCC RPTAYEDEVS FLDAHSRYHT VHELSARECA CV.Purity:Min. 95%ESE1 antibody
ESE1 antibody was raised in rabbit using N terminal sequence MAATCEISNIFSNYFS and C terminal sequence SSGWKEEEVLQSRN of the human ESE-1 protein as the immunogen.Purity:Min. 95%Desmoglein 1 antibody
Desmoglein 1 antibody was raised in mouse using recombinant human polypeptide Desmoglein 1 as the immunogen.Feline Calicivirus protein
Feline Calicivirus protein is a native protein and antigen that is widely used in the field of life sciences. It has various applications, including studying human serum samples, conducting research on lepidium, and performing assays on microtiter plates. This protein is also known for its role in opioid peptide research, as it can bind to specific antiserum and facilitate the detection of these peptides. Additionally, Feline Calicivirus protein exhibits antioxidant activity and has been studied for its potential effects on progesterone concentration and growth factor production. Its colloidal properties make it an ideal candidate for the development of monoclonal antibodies, which can be used in various diagnostic and therapeutic applications. Overall, Feline Calicivirus protein is a versatile tool that plays a crucial role in advancing scientific knowledge and understanding in multiple fields.Purity:Min. 95%TAF7L antibody
TAF7L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKLHL22 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL22 antibody, catalog no. 70R-10141Purity:Min. 95%C9ORF46 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf46 antibody, catalog no. 70R-6739Purity:Min. 95%PDHA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDHA1 antibody, catalog no. 70R-1095
Purity:Min. 95%SFRS7 antibody
SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPPGM5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGM5 antibody, catalog no. 70R-10275
Purity:Min. 95%Haemoglobin antibody
The Haemoglobin antibody is a monoclonal antibody that specifically targets human serum. It is widely used in research and diagnostic applications, particularly in the field of mass spectrometry. This monoclonal antibody has been developed using advanced techniques and exhibits high specificity and affinity for its target. It can be used in various immunoassays, such as ELISA and Western blotting, to detect and quantify haemoglobin levels accurately. Additionally, this antibody has shown potential therapeutic applications, including neutralizing the effects of certain glycoproteins and proteolytic enzymes. Its unique properties make it a valuable tool for studying haemoglobin-related disorders and developing targeted treatments.C19orf25 antibody
C19orf25 antibody was raised in rabbit using the n terminal of C19ORF25 as the immunogenPurity:Min. 95%LETM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LETM1 antibody, catalog no. 70R-1752Purity:Min. 95%PRKRA antibody
PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
Purity:Min. 95%RASGRF1 antibody
RASGRF1 antibody was raised in rabbit using the middle region of RASGRF1 as the immunogenPurity:Min. 95%PYHIN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PYHIN1 antibody, catalog no. 70R-9019Purity:Min. 95%TPO, Recombinant Protein
Thyroid Peroxidase (TPO), Recombinant ProteinPurity:>95% By Densitometric AnalysisARL8A antibody
ARL8A antibody was raised using the middle region of ARL8A corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQPurity:Min. 95%RBM3 antibody
The RBM3 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is designed to target and neutralize specific proteins and molecules related to various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying proteins such as epidermal growth factor, alpha-fetoprotein, insulin, dopamine, and histidine.NPM antibody
The NPM antibody is a highly effective binding protein that specifically targets tyrosine kinase receptors. It is available in both polyclonal and monoclonal forms, making it versatile for various research applications in the Life Sciences field. This antibody has been extensively studied and proven to exhibit cytotoxic activity against cells expressing high levels of tyrosine kinase receptors, such as those found in certain types of cancer.PRKAA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRKAA1 antibody, catalog no. 70R-5929Purity:Min. 95%ACY1 antibody
The ACY1 antibody is a monoclonal antibody that specifically targets the glycine receptor. It acts as an antagonist, blocking the binding of glycine to its receptor. This antibody has been shown to have neuroprotective effects, particularly in the context of dopamine-related neurodegenerative disorders. Additionally, it has been found to modulate hormone peptide signaling pathways, leading to potential therapeutic applications in hormone-related conditions.
MGC70924 antibody
MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR
SLC27A6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC27A6 antibody, catalog no. 70R-6791
Purity:Min. 95%RIPK5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RIPK5 antibody, catalog no. 70R-2629Purity:Min. 95%TBP antibody
The TBP antibody is a specific antibody that belongs to the group of polyclonal antibodies. It is used in Life Sciences research to detect and study the presence of TBP (TATA-binding protein), an important transcription factor involved in gene regulation. This antibody can be used to identify and quantify TBP levels in various biological samples, such as adipose tissue, liver microsomes, and insulin-secreting cells. The TBP antibody has also been used to investigate the role of TGF-beta (transforming growth factor-beta) signaling in adiponectin production and insulin sensitivity. Additionally, it can be utilized for studying the interaction between adiponectin receptors and TBP, providing valuable insights into the molecular mechanisms underlying metabolic disorders and insulin resistance.Hepatitis C Virus Nucleocapsid (Core) protein (22 kDa)
HCV core nucleocapsid immunodominant regions of Hepatitis C Virus protein containing amino acids 2-192. The protein is fused with beta galactosidase (114 kDa) at the N-terminus.Purity:Min. 95%SF3A1 antibody
SF3A1 antibody was raised using the N terminal of SF3A1 corresponding to a region with amino acids QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTKeratin K73 antibody
Keratin K73 antibody was raised in Guinea Pig using synthetic peptide of human keratin K73 coupled to KLH as the immunogen.
Purity:Min. 95%
