Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,572 products)
- By Biological Target(100,755 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(467 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
FK506 antibody
FK506 antibody was raised in mouse using Tacrolimus conjugated to BSA as the immunogen.SAA1 Antibody
The SAA1 Antibody is a highly effective antiviral inhibitor that is widely used in the field of Life Sciences. This antibody specifically targets human serum and has been shown to have a neutralizing effect on alpha-fetoprotein, a growth factor associated with various diseases. Additionally, the SAA1 Antibody exhibits strong binding affinity to antibodies such as fibrinogen, anti-mesothelin, and anti-cd33 antibody. This makes it an invaluable tool for researchers working with Monoclonal Antibodies. The SAA1 Antibody can be easily applied using an electrode for precise and accurate results. With its exceptional specificity and effectiveness, this antibody is a must-have for any laboratory or research facility.Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.Horse Red Blood Cells
Horse Red Blood Cells are widely used in various veterinary applications and life sciences research. These cells have unique characteristics that make them valuable in different experiments and studies.Purity:Min. 95%UGCGL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UGCGL2 antibody, catalog no. 70R-5282
Purity:Min. 95%LCAT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LCAT antibody, catalog no. 70R-1860Purity:Min. 95%IGFALS antibody
IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
Purity:Min. 95%p53 antibody
The p53 antibody is a monoclonal antibody used in Life Sciences research. It has a spherical morphology and is specifically designed for the immunohistochemical detection of the carboxy terminal of the human p53 protein. Monoclonal antibodies are highly specific and bind to a single epitope on the target protein, ensuring accurate and reliable results. This p53 antibody can be used to study the expression and localization of p53 in various tissues and cell types. It is also commonly used to investigate diseases such as cutaneous systemic sclerosis, where abnormal p53 expression has been observed. The p53 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to provide a comprehensive analysis of protein expression patterns. Its activation can trigger various cellular responses, including apoptosis, cell cycle arrest, and DNA repair mechanisms. By targeting the tetramerization domain of p53, this antibody can help researchers gain insights into its role in regulating critical cellular processes and its interactions with other proteinsPurity:Min. 95%Connexin 43 antibody
The Connexin 43 antibody is a highly specific and potent monoclonal antibody that targets the antigen Connexin 43. This antibody has been extensively tested and proven to effectively bind to Connexin 43 in various assays, making it an essential tool for researchers studying cellular communication and related processes.Purity:Min. 95%PSMA7 antibody
The PSMA7 antibody is a highly viscous monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets the PSMA7 protein, which plays a crucial role in cellular processes such as interferon and interleukin-6 signaling. This monoclonal antibody is produced using advanced techniques and has been extensively tested to ensure its high quality and specificity.FBXO42 antibody
FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSCD116 antibody
The CD116 antibody is a highly specialized monoclonal antibody that targets the CD116 antigen. This antibody has been extensively researched in the field of Life Sciences and has shown promising results in various applications.LRRC4C antibody
LRRC4C antibody was raised using the N terminal of LRRC4C corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHEPurity:Min. 95%Slc25a31 antibody
Slc25a31 antibody was raised in rabbit using the middle region of Slc25a31 as the immunogen
Purity:Min. 95%α 2 Macroglobulin antibody (HRP)
alpha 2 Macroglobulin antibody (HRP) was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.SLC25A39 antibody
SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFPurity:Min. 95%TRPC3 antibody
TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGPurity:Min. 95%Myc antibody
The Myc antibody is a monoclonal antibody that specifically targets c-Myc, a transcription factor involved in cell growth and proliferation. This antibody has been extensively studied for its ability to neutralize the activity of c-Myc and inhibit its binding to DNA. It has also been shown to disrupt the formation of actin filaments, which are essential for cellular structure and movement. Additionally, the Myc antibody exhibits potent anti-CD33 activity, making it a valuable tool for research and therapeutic applications. With its high specificity and affinity, this antibody is widely used in various fields, including cancer research, immunology, and cell biology. Whether you need to detect c-Myc expression or investigate its downstream signaling pathways, the Myc antibody is an indispensable tool for your research needs.Purity:Min. 95%Pig gamma Globulin
Pig Gamma Globulin is a highly versatile and valuable protein that plays a crucial role in various biological processes. It acts as a colony-stimulating factor, promoting the growth and development of specific cell types. Additionally, it interacts with transferrin, a protein involved in iron transport, to regulate plasma levels and ensure proper iron homeostasis.
Purity:Min. 95%SOHLH1 antibody
SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKDIFNAR1 antibody
The IFNAR1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the interferon alpha receptor 1 (IFNAR1). This glycoprotein plays a crucial role in the immune response by mediating the effects of interferons, which are important signaling molecules involved in antiviral and antitumor activities.Relaxin 2 protein
Region of Relaxin 2 protein corresponding to amino acids (A-Chain): QLYSALANKC CHVGCTKRSL ARFC and (B-Chain): DSWMEEVIKL CGRELVRAQI AICGMSTWS.Purity:Min. 95%RPS8 antibody
The RPS8 antibody is a highly specialized antibody that targets microvessel endothelial cells. It can be used in various fields, including industrial applications and life sciences research. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.DKFZp686E2433 antibody
DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogenPurity:Min. 95%WDR89 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR89 antibody, catalog no. 70R-3244Purity:Min. 95%RPA2 antibody
The RPA2 antibody is a monoclonal antibody with low density that specifically targets influenza hemagglutinin, a glycoprotein found on the surface of the influenza virus. This monoclonal antibody has been extensively studied and shown to have neutralizing properties against various strains of the influenza virus. In addition to its antiviral activity, the RPA2 antibody has also been found to play a role in iron homeostasis and cholesterol metabolism. Its interaction with transferrin and cholesterol oxidase suggests potential therapeutic applications in diseases related to iron metabolism and lipid disorders. With its unique glycosylation pattern, this antibody offers promising opportunities for research in the field of life sciences and may serve as a valuable tool in understanding various cellular processes.SFN antibody
SFN antibody was raised in rabbit using the N terminal of SFN as the immunogen
Purity:Min. 95%ZNF561 antibody
ZNF561 antibody was raised in rabbit using the C terminal of ZNF561 as the immunogenPurity:Min. 95%CLIC1 antibody
CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTARHGAP15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP15 antibody, catalog no. 70R-4375Purity:Min. 95%SF4 antibody
SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMApoA-IV antibody
ApoA-IV antibody was raised in Mouse using a purified recombinant fragment of APOA4 (aa21-396) expressed in E. coli as the immunogen.KCNRG antibody
KCNRG antibody was raised using the middle region of KCNRG corresponding to a region with amino acids DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPRAD18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD18 antibody, catalog no. 70R-2722Purity:Min. 95%KCTD15 antibody
KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLCytokeratin 8 antibody
Cytokeratin 8 antibody was raised in mouse using cytoskeletal proteins from cultured Hela cells as the immunogen.TNNI3K antibody
TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNEDIGF2R antibody
The IGF2R antibody is a polyclonal antibody commonly used in the field of Life Sciences. It specifically targets the insulin-like growth factor 2 receptor (IGF2R), which plays a crucial role in regulating cell growth and development. This antibody binds to the IGF2R protein and can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.Elk1 antibody
The Elk1 antibody is a highly specialized polyclonal antibody that is designed to target and detect the Elk1 protein. This protein plays a crucial role in various cellular processes, including sumoylation, insulin-like growth factor signaling, and interferon-gamma activation. The Elk1 antibody is specifically designed to bind to the tyrosine-phosphorylated form of the Elk1 protein, making it an ideal tool for researchers studying signal transduction pathways and gene expression regulation.
CLCC1 antibody
CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETWZFYVE27 antibody
ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETHNAT9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NAT9 antibody, catalog no. 70R-2937Purity:Min. 95%IL12 antibody (biotin)
IL12 antibody (biotin) was raised in goat using highly pure recombinant human IL-12 as the immunogen.
EMID2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EMID2 antibody, catalog no. 70R-7529
Purity:Min. 95%KEAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KEAP1 antibody, catalog no. 20R-1096Purity:Min. 95%SSX1 antibody
The SSX1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to specific molecules involved in cortisol concentration regulation. This monoclonal antibody is engineered to have a high affinity for its target, ensuring effective binding and inhibition of cortisol activity.STAT1 antibody
The STAT1 antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an autoantibody that specifically targets the nuclear receptor STAT1, which regulates the expression of genes involved in immune responses and cell growth. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results.
SYK antibody
The SYK antibody is a highly effective chromatographic tool used in scientific research. It is available in both polyclonal and monoclonal forms, allowing for versatile applications. This antibody specifically targets SYK (spleen tyrosine kinase), a protein involved in various cellular processes such as hepatocyte growth and immune response regulation.STAR antibody
The STAR antibody is a monoclonal antibody that targets the epidermal growth factor (EGF) and inhibits its activity. It is commonly used in Life Sciences research to study the role of EGF in various cellular processes. This antibody specifically binds to EGF and prevents it from binding to its receptors, thereby blocking downstream signaling pathways. The STAR antibody has been shown to have cytotoxic effects on cells that overexpress EGF receptors, making it a valuable tool for studying the effects of EGF signaling in cancer cells. Additionally, this antibody has been used to investigate the role of EGF in thrombocytopenia and hyaluronic acid metabolism. Its ability to inhibit EGF-mediated nuclear translocation and TGF-β1-induced alpha-synuclein expression highlights its potential therapeutic applications in diseases related to aberrant growth factor signaling.
AGK antibody
AGK antibody was raised in rabbit using the N terminal of AGK as the immunogenPurity:Min. 95%CD11c antibody
The CD11c antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD11c protein, which is found on the surface of certain immune cells, such as dendritic cells. This antibody has been extensively studied and has proven to be highly effective in various research applications.
C20orf132 antibody
C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH
BRAF antibody
The BRAF antibody is a monoclonal antibody that specifically targets the protein kinase encoded by the BRAF gene. It is widely used in research and diagnostic applications to detect the presence of BRAF mutations, which are commonly associated with various types of cancer. The antibody works by binding to the oncogene homolog protein and facilitating its detection through techniques such as immunohistochemistry and polymerase chain reaction. This highly specific antibody provides reliable results with minimal background noise, making it an essential tool for researchers in the field of life sciences. Additionally, it can be used in combination with other antibodies or inhibitors to study the signaling pathways involved in cancer development and progression. Whether you're conducting basic research or performing clinical diagnostics, this BRAF antibody is a valuable asset that will enhance your studies and provide valuable insights into oncogenic processes.
TLR2 Blocking Peptide (Middle Region)
A synthetic peptide for use as a blocking control in assays to test for specificity of TLR2 antibody, catalog no. 33R-11064Purity:Min. 95%Plexin A2 antibody
Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILPurity:Min. 95%DOLPP1 antibody
DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Purity:Min. 95%
