Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,743 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(454 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
GGPS1 antibody
GGPS1 antibody was raised using the C terminal of GGPS1 corresponding to a region with amino acids LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENENNT1 protein
Region of NNT1 protein corresponding to amino acids MLNRTGDPGP GPSIQKTYDL TRYLEHQLRS LAGTYLNYLG PPFNEPDFNP PRLGAETLPR ATVDLEVWRS LNDKLRLTQN YEAYSHLLCY LRGLNRQAAT AELRRSLAHF CTSLQGLLGS IAGVMAALGY PLPQPLPGTE PTWTPGPAHS DFLQKMDDFW LLKELQTWLW RSAKDFNRLK KKMQPPAAAV TLHLGAHGF.Purity:Min. 95%NFkB p65 antibody
The NFkB p65 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to the NFkB p65 protein, which plays a crucial role in various cellular processes. This antibody is widely used in research and diagnostic applications to study the function and regulation of NFkB signaling pathways.HORMAD2 antibody
HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII
DROSHA antibody
The DROSHA antibody is a high-quality monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein DROSHA, which plays a crucial role in the processing of microRNAs. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and flow cytometry.
Neurturin protein
Region of Neurturin protein corresponding to amino acids ARLGARPCGL RELEVRVSEL GLGYASDETV LFRYCAGACE AAARVYDLGL RRLRQRRRLR RERVRAQPCC RPTAYEDEVS FLDAHSRYHT VHELSARECA CV.Purity:Min. 95%A630025C20RIK antibody
A630025C20RIK antibody was raised in rabbit using the N terminal of A630025C20RIK as the immunogenPurity:Min. 95%KCNH5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH5 antibody, catalog no. 70R-5121Purity:Min. 95%Caldesmon antibody
The Caldesmon antibody is a highly specialized inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to caldesmon, a protein involved in transmembrane conductance and cellular signaling pathways. This antibody has cytotoxic properties, making it an essential tool for studying the function of caldesmon in various cellular processes.SDF1 α antibody
SDF1a antibody was raised in rabbit using E. Coli-expressed amino acids 20-89 of murine SDF-1 alpha as the immunogen.Purity:Min. 95%MAGEA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA2 antibody, catalog no. 70R-9921Purity:Min. 95%MyoD antibody
The MyoD antibody is a powerful tool used in immunoassays and bioassays for the detection and quantification of MyoD, a transcription factor involved in muscle development. This antibody can be used in various applications, including electrochemical impedance spectroscopy, where it enables the measurement of changes in impedance caused by the antigen-antibody reaction. The MyoD antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. It has been extensively validated for its specificity and sensitivity in detecting MyoD in different sample types.Purity:Min. 95%CBP80 antibody
The CBP80 antibody is a protein that specifically targets and binds to the CBP80 protein. It has been shown to have autoantibodies against basic proteins and TNF-related apoptosis-inducing ligand (TRAIL), which are growth factors involved in cell death regulation. The CBP80 antibody can be used in various research applications, such as immunohistochemistry, Western blotting, and ELISA assays. It is commonly used to detect the presence of specific proteins in biological samples, including human serum or tissue extracts. This antibody is a valuable tool for researchers in the life sciences field who are studying various target molecules, such as alpha-fetoprotein or erythropoietin.
GBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GBP2 antibody, catalog no. 70R-4040Purity:Min. 95%Carbonic Anhydrase VIII antibody
Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCSERPINB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB2 antibody, catalog no. 70R-6016Purity:Min. 95%Tubulin antibody
Tubulin antibody was raised in mouse using Chicken skeletal muscle cell preparation as the immunogen.GLUT1 antibody
The GLUT1 antibody is a highly specialized antibody that plays a crucial role in sugar transport across cell membranes. It is commonly used in various scientific and medical research applications. This antibody specifically targets the glucose transporter protein 1 (GLUT1), which is responsible for transporting glucose into cells.UCHL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL5 antibody, catalog no. 70R-9729Purity:Min. 95%EIF4E antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains, leading to the inhibition of cell growth in culture.DIRAS1 antibody
DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKPurity:Min. 95%HELT antibody
HELT antibody was raised in rabbit using the middle region of HELT as the immunogenPurity:Min. 95%C4ORF20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C4orf20 antibody, catalog no. 70R-3548Purity:Min. 95%ZNF572 antibody
ZNF572 antibody was raised in rabbit using the N terminal of ZNF572 as the immunogenPurity:Min. 95%POFUT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POFUT2 antibody, catalog no. 70R-5486Purity:Min. 95%PROM2 antibody
The PROM2 antibody is a powerful tool in the field of Life Sciences. It is an anti-angiogenesis agent that targets alpha-fetoprotein, a growth factor involved in tumor development and progression. The PROM2 antibody has been extensively studied and has shown promising results in inhibiting the growth of tumors by interfering with the activity of alpha-fetoprotein.LPL antibody
The LPL antibody is a monoclonal antibody that specifically targets and binds to lipoprotein lipase (LPL). It is an acidic antibody that has been biotinylated for easy detection and labeling purposes. The LPL antibody is derived from bovine γ-globulin and has been extensively characterized for its specificity and affinity towards LPL.RFPL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RFPL3 antibody, catalog no. 70R-2782Purity:Min. 95%MCL1 antibody
The MCL1 antibody is a glycoprotein that plays a crucial role in cell survival and apoptosis regulation. It is involved in the binding of activated Bcl-2 family proteins, which control the intrinsic pathway of apoptosis. This antibody is commonly used in various assays and research studies to detect and quantify MCL1 expression levels.
GABRB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GABRB2 antibody, catalog no. 70R-5191
Purity:Min. 95%IL9 antibody
IL9 antibody was raised in rabbit using highly pure recombinant human IL-9 as the immunogen.NEK11 antibody
NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
CD9 antibody
The CD9 antibody is a highly activated monoclonal antibody that is used in the field of Life Sciences. It is produced by a hybridoma cell line and has been specifically designed to target the CD9 protein. This antibody has a high affinity for CD9, allowing it to bind to and neutralize its proteolytic activity.ENSA antibody
ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLVEGFR2 antibody
The VEGFR2 antibody is a highly specialized polyclonal antibody that is used in various applications within the field of Life Sciences. This antibody specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2), which plays a crucial role in angiogenesis and blood vessel development.Purity:Min. 95%RNF44 antibody
RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPLKIF23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF23 antibody, catalog no. 70R-5544Purity:Min. 95%ADORA1 antibody
ADORA1 antibody was raised in rabbit using the C terminal of ADORA1 as the immunogenPurity:Min. 95%GFRA4 antibody
The GFRA4 antibody is an affinity ligand that specifically targets interleukin receptors. It has been isolated from retinal tissue and can be used as a test compound in various research studies. This antibody shows potential for the development of new medicines, particularly in the field of nuclear medicine and anti-thrombotic therapies. The GFRA4 antibody is part of a group of antibodies known as polyclonal antibodies, which are widely used as inhibitors or intermediates in various biomedical applications. Additionally, it has shown promise in the detection and treatment of autoantibodies and can be utilized in adeno-associated virus-based therapies. With its versatility and specificity, the GFRA4 antibody holds great potential for advancing scientific research and medical advancements.
Fibrillarin antibody
Fibrillarin antibody is a polyclonal antibody that is commonly used in life sciences research. It plays a crucial role in various cellular processes, including epidermal growth factor signaling, collagen synthesis, and transferrin regulation. This antibody has been shown to have neutralizing effects on transforming growth factor-beta (TGF-beta), which is involved in cell proliferation and differentiation. Additionally, it has been used as a tool to study the effects of vasoactive intestinal peptide and ketamine on neuronal activity. Fibrillarin antibody is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications in the field of antibodies and multidrug research.
Purity:Min. 95%Goat anti Human IgG (FITC)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%C18ORF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C18orf25 antibody, catalog no. 70R-3729Purity:Min. 95%POSTN antibody
The POSTN antibody is a monoclonal antibody that specifically targets the basic protein POSTN. This antibody is commonly used in life sciences research to study the role of POSTN in various cellular processes. It has been shown to interact with other proteins such as histidine, TGF-beta, collagen, and growth factors. The POSTN antibody is particularly useful for detecting and quantifying the expression levels of POSTN in different cell types and tissues. Its specificity and high affinity make it a valuable tool for understanding the function of this protein in development, wound healing, and tissue remodeling. Additionally, the POSTN antibody can be used in immunohistochemistry, Western blotting, and other experimental techniques to investigate the activation of β-catenin and epidermal growth factor signaling pathways.Ebola Virus NP protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Extensive research has demonstrated its efficacy through the use of advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets and inhibits cell growth in Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and potency against tuberculosis, 6-Fluoro-3-indoxyl-beta-D-galactPurity:Min. 95%CTDSP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTDSP2 antibody, catalog no. 70R-3514
Purity:Min. 95%WDR21A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR21A antibody, catalog no. 70R-3466Purity:Min. 95%TAU antibody
The TAU antibody is a diagnostic agent used in Life Sciences research. It is a monoclonal antibody that specifically targets the cytosolic protein TAU. This antibody has high affinity and specificity for TAU and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. The TAU antibody can also be conjugated to different labels for visualization purposes. Its biophysical properties make it an ideal tool for studying the role of TAU in neurodegenerative diseases such as Alzheimer's disease. Additionally, this antibody has been shown to bind to amyloid plaques in the brain, providing valuable insights into the pathology of these diseases. Its peptide binding capabilities allow for precise targeting of TAU and its associated proteins, making it an essential tool in the field of neuroscience research.HSZFP36 antibody
HSZFP36 antibody was raised in rabbit using the middle region of HSZFP36 as the immunogenPurity:Min. 95%GAP43 antibody
The GAP43 antibody is a human monoclonal antibody that is widely used in the field of Life Sciences. It has been shown to have cytotoxicity against pluripotent cells and is commonly used as a research tool for studying oncogenic kinases. This antibody can be utilized for various applications, including sample composition analysis, biochemical assays, and antigen detection. Additionally, it can be used in flow cytometry experiments to detect human polymorphonuclear leukocytes. With its high specificity and affinity, the GAP43 antibody is an essential tool for researchers working in the field of antibodies and monoclonal antibodies.KCNC3 antibody
KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMTGFB1 antibody
TGFB1 antibody was raised in rabbit using the middle region of TGFB1 as the immunogenPurity:Min. 95%CD83 antibody
The CD83 antibody is a monoclonal antibody that targets the CD83 protein. It plays a crucial role in the field of Life Sciences and has various applications in research and diagnostics. This antibody specifically recognizes the CD83 protein, which is expressed on the surface of dendritic cells. It can be used to study the function and activation of dendritic cells, as well as their interaction with other immune cells.RBM12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM12 antibody, catalog no. 70R-5031
Purity:Min. 95%SSB antibody
SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLSIRT5 antibody
The SIRT5 antibody is a highly specific monoclonal antibody that targets the antigen SIRT5. It is commonly used in various research applications, including immunohistochemistry staining and western blotting. This antibody has high affinity and specificity for its target and can be used as a valuable tool in studying the role of SIRT5 in various biological processes.
HNRNPR antibody
HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQPDCD1 antibody
PDCD1 antibody was raised in mouse using recombinant human PDCD1 (21-167aa) purified from E. coli as the immunogen.VIM antibody
The VIM antibody is a colloidal growth factor that acts as an inhibitor of tumor necrosis factor-α (TNF-α). It also binds to brain natriuretic peptide and histidine, making it a versatile tool in Life Sciences research. This antibody is part of the family of monoclonal antibodies that have neutralizing properties against various targets, including β-catenin and epidermal growth factor. Additionally, the VIM antibody has been found to exhibit neutralizing effects against botulinum toxin. With its wide range of applications, this antibody is an essential tool for researchers in the field.C19ORF56 antibody
C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLPurity:Min. 95%ALG11 antibody
ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAESPurity:Min. 95%
