Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,661 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Borrelia OspC protein
Borrelia OspC protein is a highly specific monoclonal antibody that is used in the field of Life Sciences. It is an activated recombinant protein that can be used for various applications such as immunohistochemistry, Western blotting, and ELISA. The Borrelia OspC protein is produced using hybridoma cells and has been shown to have high affinity and specificity for its target antigen. It can be used in research studies to detect and quantify the presence of this specific protein in samples such as human hepatocytes or other cell lines. Additionally, polyclonal antibodies against the Borrelia OspC protein are also available, providing researchers with more options for their experiments. With its unique characteristics and wide range of applications, the Borrelia OspC protein is a valuable tool for scientists working in the field of Proteins and Antigens.Purity:Min. 95%ARF1 antibody
ARF1 antibody was raised in mouse using recombinant human ARF1 (1-181aa) purified from E. coli as the immunogen.SPINK6 antibody
SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen
Purity:Min. 95%MAK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAK antibody, catalog no. 70R-2672
Purity:Min. 95%Pitx1 antibody
Pitx1 antibody was raised in rabbit using the middle region of Pitx1 as the immunogenPurity:Min. 95%Tektin 4 antibody
Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA
SLC5A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A11 antibody, catalog no. 70R-6545Purity:Min. 95%CDK9 antibody
CDK9 antibody was raised in rabbit using the N terminal of CDK9 as the immunogenPurity:Min. 95%WDR89 antibody
WDR89 antibody was raised using the middle region of WDR89 corresponding to a region with amino acids TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRPKC zeta antibody
The PKC zeta antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is commonly utilized for its binding properties to proteins involved in growth factor signaling pathways. This antibody specifically targets lysine-specific binding proteins and has been shown to be effective in detecting and quantifying various growth factors, including the anti-HER2 antibody trastuzumab.Complement C2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2 antibody, catalog no. 70R-5918Purity:Min. 95%OXR1 antibody
OXR1 antibody was raised using the N terminal of OXR1 corresponding to a region with amino acids VESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVV
ZNF554 antibody
ZNF554 antibody was raised in rabbit using the N terminal of ZNF554 as the immunogenPurity:Min. 95%PNMT antibody
The PNMT antibody is a diagnostic agent that belongs to the class of antibodies. It has a high affinity for galectin-3-binding protein and can be used in various research applications in the Life Sciences field. This antibody specifically targets catecholaminergic neurons and can be used to study their function and distribution. Additionally, it has been shown to have potential therapeutic applications in targeting growth factors and chemokines involved in various diseases. The PNMT antibody is a valuable tool for researchers working in the field of neuroscience and protein-coupled receptor signaling.Connexin 43 antibody
The Connexin 43 antibody is a monoclonal antibody that targets the Connexin 43 protein. This protein plays a crucial role in cell-to-cell communication and is involved in various cellular processes such as hepatocyte growth, thrombocytopenia, and nephrotoxicity. By targeting Connexin 43, this antibody can modulate these processes and potentially offer therapeutic benefits.CD34 Antibody
The CD34 Antibody is a highly effective medicament used in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD34, a protein found on the surface of hematopoietic stem cells and endothelial progenitor cells. This antibody plays a crucial role in inhibiting the growth and proliferation of these cells.
TJP2 antibody
TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTELC1S antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders their cell growth in culture. Tilmicosin is a macrolide antibiotic primarily used in veterinary medicine for treating respiratory disorders caused by bacteria like Clostridium perfringCD8b antibody
CD8b antibody was raised in Mouse using the beta chain of chicken CD8 as the immunogen.NDKA antibody
The NDKA antibody is a specific antibody that targets alpha-fetoprotein (AFP), a protein that is often elevated in certain diseases and conditions. This antibody acts as a family kinase inhibitor, blocking the activity of proteins involved in cell signaling pathways. It can be used in various research applications, including Western blotting, immunohistochemistry, and ELISA assays. The NDKA antibody is produced using polyclonal or monoclonal antibody production methods, ensuring high specificity and sensitivity. It can be used to study the role of AFP in different biological processes, such as development, cancer progression, and hormone regulation. The NDKA antibody is supplied with saponin for enhanced permeabilization of cells during staining procedures. It has been validated for use in various species and sample types, including human serum and tissue samples. With its ability to target AFP specifically, the NDKA antibody is an invaluable tool for researchers in the Life Sciences field.LGR6 antibody
The LGR6 antibody is a protein that belongs to the group of polyclonal antibodies. It is commonly used in life sciences research for various applications. This antibody specifically targets LGR6, a receptor protein involved in several biological processes. It has been shown to have autoantibody properties and can be used in immunohistochemistry and immunofluorescence assays to detect LGR6 expression in tissues or cells.TERF2 antibody
TERF2 antibody was raised in rabbit using the C terminal of TERF2 as the immunogenPurity:Min. 95%GNPDA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNPDA1 antibody, catalog no. 70R-3271Purity:Min. 95%ATP5B antibody
ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQCarboxyl Ester Lipase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CEL antibody, catalog no. 70R-5366
Purity:Min. 95%TSPAN12 antibody
The TSPAN12 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets TSPAN12, a glycoprotein found on the surface of human cells. This antibody has been extensively studied and shown to have cytotoxic effects on various cell types, including cardiomyocytes.
KCNJ12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNJ12 antibody, catalog no. 70R-5160
Purity:Min. 95%MST1R antibody
MST1R antibody was raised in Mouse using a purified recombinant fragment of human MST1R (aa210-320) expressed in E. coli as the immunogen.ZNF682 antibody
ZNF682 antibody was raised in rabbit using the middle region of ZNF682 as the immunogenPurity:Min. 95%IGF2BP2 antibody
The IGF2BP2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that has been extensively studied and characterized using mass spectrometric methods. This antibody plays a crucial role in various biological processes, including syncytia formation, growth factor signaling, and virus surface antigen activation.EDG6 antibody
The EDG6 antibody is a protein that acts as a phosphatase. It is a polyclonal antibody that is commonly used in the field of life sciences. This antibody specifically targets the hepatocyte growth factor, which plays a crucial role in cell growth and development. The EDG6 antibody can be used to detect and measure the levels of this growth factor in various biological samples. Additionally, this antibody has been shown to interact with other proteins such as fibrinogen, steroids, glycosylation enzymes, natriuretic peptides, mycoplasma genitalium, activated dopamine receptors, and growth factors. Its specificity and high affinity make it an essential tool for researchers studying these pathways. Order your EDG6 antibody today and unlock new insights into cellular signaling and protein interactions.1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9
CAS:Controlled Product1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9 is a deuterated phospholipid, which is an important tool in biophysical research. This molecule is sourced from the synthetic modification of natural phosphatidylcholine, incorporating deuterium atoms to enhance its utility in specialized studies. The deuterium labeling replaces hydrogen atoms, which significantly reduces background noise and enhances signal clarity in spectroscopic techniques like NMR and neutron scattering.Formula:C40H9NO8PD71Purity:Min. 95%Molecular weight:805.48 g/molPHKG2 antibody
PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVEPHX1 antibody
EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
Purity:Min. 95%SPINT2 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of the bacteria. Extensive research has been conducted on its human activity using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations like hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.Purity:Min. 95%RASSF1 antibody
RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogenPurity:Min. 95%OXCT1 antibody
OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINPurity:Min. 95%GABARAP antibody
GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.Purity:Min. 95%TRIM37 antibody
TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQmolecular weight (Uniprot) is 108kDa
Progesterone
Progesterone is a steroid hormone that acts as a nuclear receptor in the body. It plays a crucial role in various physiological processes, including the menstrual cycle and pregnancy. Progesterone can be measured in blood plasma using immunoassays, such as flow assays, which utilize monoclonal antibodies specific to progesterone. These antibodies bind to progesterone molecules, allowing for accurate measurement of progesterone concentration. Synthetic progesterone analogs have also been developed for use in research and medical applications. Additionally, surface modification techniques can be employed to immobilize monoclonal antibodies on solid supports, enabling the development of robust and sensitive progesterone detection systems. Overall, progesterone is a vital hormone with diverse functions and its measurement is essential in various fields, including Life Sciences and clinical diagnostics.Purity:Min. 95%TrkA antibody
The TrkA antibody is a highly specialized monoclonal antibody that targets the growth factor receptor TrkA. This receptor plays a crucial role in cell growth, survival, and differentiation. By binding to the virus surface antigen, the TrkA antibody effectively inhibits the activation of this receptor, preventing abnormal cell growth and proliferation.ZNF565 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF565 antibody, catalog no. 70R-8994Purity:Min. 95%MAPKAPK2 antibody
MAPKAPK2 antibody was raised in rabbit using the middle region of MAPKAPK2 as the immunogenTMEM144 antibody
TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDLPurity:Min. 95%ZNF618 antibody
ZNF618 antibody was raised in rabbit using the N terminal of ZNF618 as the immunogenPurity:Min. 95%CLIC1 protein (His tag)
1-241 amino acids: MGSSHHHHHH SSGLVPRGSH MAEEQPQVEL FVKAGSDGAK IGNCPFSQRL FMVLWLKGVT FNVTTVDTKR RTETVQKLCP GGQLPFLLYG TEVHTDTNKI EEFLEAVLCP PRYPKLAALN PESNTAGLDI FAKFSAYIKN SNPALNDNLE KGLLKALKVL DNYLTSPLPE EVDETSAEDE GVSQRKFLDG NELTLADCNL LPKLHIVQVV CKKYRGFTIP EAFRGVHRYL SNAYAREEFA STCPDDEEIE LAYEQVAKAL KPurity:Min. 95%BNIP1 antibody
BNIP1 antibody was raised in rabbit using the C terminal of BNIP1 as the immunogen
Purity:Min. 95%XRCC5 antibody
The XRCC5 antibody is a cytotoxic monoclonal antibody that specifically targets XRCC5, a protein involved in DNA repair. This antibody has been shown to have high specificity and affinity for XRCC5, making it an effective tool for studying the function of this protein in various biological processes. The XRCC5 antibody can be used in applications such as immunohistochemistry, western blotting, and flow cytometry to detect and quantify XRCC5 levels in different cell types and tissues. Additionally, this antibody has potential therapeutic applications, as it can induce cell death in cancer cells that overexpress XRCC5. Overall, the XRCC5 antibody is a valuable research tool for scientists studying DNA repair mechanisms and developing targeted therapies for cancer treatment.SKP2 antibody
The SKP2 antibody is a highly activated and colloidal growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has neutralizing properties and can effectively target autoantibodies. This antibody undergoes acid modifications, such as glycosylation, which enhance its stability and efficacy. The SKP2 antibody specifically targets the protein kinase SKP2, which plays a crucial role in cell cycle regulation and tumor development. In Life Sciences research, this monoclonal antibody is widely used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal test compound for studying the functions of SKP2 in cellular processes.Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%SLC9A8 antibody
SLC9A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
Purity:Min. 95%Alpha synuclein antibody
The Alpha synuclein antibody is a cytotoxic antibody used in Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets alpha synuclein, a protein that is associated with neurodegenerative diseases such as Parkinson's disease. The alpha synuclein antibody can be used for research purposes to study the role of this protein in various cellular processes.PYHIN1 antibody
PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogenPurity:Min. 95%TRIM49 antibody
TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFDBH antibody
DBH antibody was raised in rabbit using an 18 amino acid peptide of human DBH as the immunogen.Purity:Min. 95%Annexin A2 antibody
Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDDPerforin antibody
Perforin antibody was raised in rabbit using E. coli-expressed rat perforin as the immunogen.Purity:Min. 95%SIGLEC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6067Purity:Min. 95%TGFBR2 antibody
The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.
NRG4 antibody
The NRG4 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of nuclear retinoid receptors. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. The NRG4 antibody works by blocking the acetylation process that is crucial for the activation of retinoid receptors, thereby preventing their interaction with DNA and subsequent gene expression. This inhibition has been shown to have significant effects on various cellular processes, including collagen production, which makes it a valuable tool for studying and understanding the role of retinoids in cell biology. Additionally, the NRG4 antibody can be used in the development of novel medicines and vaccines targeting retinoid-related diseases and disorders. Its specificity and efficacy make it an essential component in research and diagnostic applications requiring reliable and accurate detection of retinoid receptors.RORA antibody
The RORA antibody is a highly specialized antibody that targets the retinoid-related orphan receptor alpha (RORA). This receptor plays a crucial role in regulating gene expression and is involved in various biological processes, including immune response, metabolism, and circadian rhythm. The RORA antibody can be used for research purposes in the field of life sciences to study the function and activity of this important receptor.CYTB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYTB antibody, catalog no. 70R-7028Purity:Min. 95%FOXN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds known for their bactericidal activity. Through its unique mechanism, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high efficacy in human subjects.GSTK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSTK1 antibody, catalog no. 70R-2610
Purity:Min. 95%CLEC4M Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLEC4M antibody, catalog no. 70R-8545Purity:Min. 95%TIMELESS antibody
TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogenPurity:Min. 95%TMEM93 antibody
TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Purity:Min. 95%ZNF596 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF799 antibody, catalog no. 70R-8173Purity:Min. 95%TMEM187 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM187 antibody, catalog no. 70R-7383Purity:Min. 95%HDAC10 antibody
The HDAC10 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 10 (HDAC10) protein. HDAC10 is a member of the histone deacetylase family that plays a crucial role in gene expression regulation. This antibody is widely used in Life Sciences research to study the function and activity of HDAC10.
ATG4D Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG4D antibody, catalog no. 70R-9614Purity:Min. 95%CD71 antibody
The CD71 antibody is a polyclonal antibody that is widely used in Life Sciences research. It is commonly used in studies involving neuroprotection, as well as the detection and quantification of active agents. The CD71 antibody has been shown to have a high affinity for methyl methanesulfonate (MMS), a genotoxic agent often used in genotoxicity assays. Additionally, this antibody can be conjugated with fluorescent calcium indicators to study intracellular calcium dynamics. It is also commonly used in the detection of autoantibodies and growth factors. The CD71 antibody has been validated in various assays, including the micronucleus test, and has shown excellent performance and specificity. Its use can provide valuable insights into cellular processes and signaling pathways.
