Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ASAH1 antibody
ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP
Purity:Min. 95%BOLA3 protein
BOLA3 protein is a vital component in the field of Life Sciences. It is an endogenous erythropoietin that plays a significant role in promoting the growth and development of adipose tissues. BOLA3 protein has been extensively studied and has shown promising results in various research areas. It can be used as a target for carbon quantum-based peptide agents, monoclonal antibodies, or other therapeutic interventions. Additionally, BOLA3 protein has been found to have neutralizing properties against TGF-beta, a key regulator of cell growth and differentiation. Its potential applications in the development of medicaments and conjugated proteins make it a valuable asset in the field of molecular biology and drug discovery. With its wide range of characteristics, BOLA3 protein offers exciting opportunities for further exploration and utilization in various scientific endeavors.Purity:Min. 95%PCK antibody
PCK antibody is a monoclonal antibody that specifically targets the tyrosine phosphorylation of PCK, which is an important protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of cancer cells. It has also been found to have potential therapeutic applications in targeting interleukin-6 signaling, as well as circumsporozoite protein-mediated immune responses. Additionally, PCK antibody has been used as a valuable tool for studying actin filaments and their role in cell motility and migration. With its high specificity and affinity, this antibody offers researchers a reliable tool for investigating various signaling pathways and molecular interactions in the field of Life Sciences.NRBP2 antibody
NRBP2 antibody was raised using the middle region of NRBP2 corresponding to a region with amino acids VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELHSC70 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Its potency has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
TGFB2 antibody
The TGFB2 antibody is a highly specialized antibody that targets the protein transforming growth factor beta 2 (TGFB2). It belongs to the class of antibodies known as polyclonal antibodies, which are produced by multiple B cell clones and can recognize different epitopes on the target antigen. This antibody is widely used in life sciences research to study the role of TGFB2 in various biological processes.TRPM4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.PGRMC1 antibody
PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPurity:Min. 95%ADNP antibody
ADNP antibody was raised in rabbit using human 114 kDA hADNP protein as the immunogen.
Purity:Min. 95%SCN1B antibody
SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSPurity:Min. 95%GAD67 antibody
The GAD67 antibody is a polyclonal antibody that targets autoantibodies against the enzyme glutamate decarboxylase 67 (GAD67). This antibody is commonly used in Life Sciences research to study the role of GAD67 in various biological processes. It can be used for applications such as immunohistochemistry, Western blotting, and ELISA.Purity:Min. 95%EHMT2 antibody
EHMT2 antibody was raised in rabbit using the N terminal of EHMT2 as the immunogen
Purity:Min. 95%MCP2 antibody
MCP2 antibody was raised in rabbit using recombinant human MCP-2 as the immunogen.Purity:Min. 95%SNAP25 antibody
The SNAP25 antibody is a monoclonal antibody that specifically targets clostridial neurotoxins. It is widely used in the field of Life Sciences for research purposes. This antibody has been shown to effectively neutralize the effects of clostridial neurotoxins by binding to them and preventing their interaction with target cells. The SNAP25 antibody is highly specific and does not cross-react with other proteins or molecules commonly found in biological samples. It has been extensively tested in various sample matrices, including human serum, and has shown excellent performance. Additionally, this antibody has been proven to be stable under different storage conditions and retains its activity even after multiple freeze-thaw cycles. Researchers rely on the SNAP25 antibody for its reliability and accuracy in detecting and quantifying clostridial neurotoxins in their experiments.beta Tubulin antibody
The beta Tubulin antibody is a highly specific monoclonal antibody that targets the beta-tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes such as intracellular transport and cell shape maintenance.ID3 antibody
The ID3 antibody is a monoclonal antibody that specifically targets and binds to the protein ID3. This protein is involved in cholinergic signaling and plays a crucial role in various cellular processes. The ID3 antibody can be used for research purposes, such as studying the function of ID3 in different cell types or investigating its role in disease development.nNOS antibody (Ser852)
Synthetic human phosphopeptide nNOS (Ser847) region immunogen, Rabbit polyclonal nNOS antibody (Ser852)OSBPL3 antibody
OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQECD86 antibody
CD86 antibody was raised in Mouse using a purified recombinant fragment of human CD86 expressed in E. coli as the immunogen.Sheep Red Blood Cells
Sheep Red Blood Cells are an essential component in various scientific and medical research applications. These cells are commonly used in the development of monoclonal antibodies, particularly those targeting glial fibrillary acidic protein (GFAP). Additionally, Sheep Red Blood Cells have been utilized in studies involving collagen, antiviral interferon, and other life sciences research.
Purity:Min. 95%SUFU antibody
The SUFU antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists working in various applications such as flow immunoassays, electrochemical impedance, and crystal microbalance studies. This antibody is available in both monoclonal and polyclonal forms, providing flexibility and options for different experimental needs.BRDU antibody
The BRDU antibody is a highly effective medicament that belongs to the class of activated monoclonal antibodies. It specifically targets the nuclear glycoprotein, e-cadherin, and inhibits its expression. This antibody is widely used in Life Sciences for various biochemical studies and research purposes. It is commonly employed in experiments involving the detection and quantification of cell proliferation and DNA synthesis. The BRDU antibody is a valuable tool for scientists and researchers working in fields such as cancer biology, immunology, and developmental biology. With its exceptional specificity and reliability, this monoclonal antibody is an essential component of any laboratory's toolkit.PDLIM2 antibody
The PDLIM2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target and detect e-cadherin expression, a protein involved in cell adhesion and signaling. This antibody is ideal for researchers and scientists working on projects related to e-cadherin, as it allows for precise detection and analysis.
LOH11CR2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOH11CR2A antibody, catalog no. 70R-9303Purity:Min. 95%AK1 antibody
The AK1 antibody is a highly specialized monoclonal antibody that targets the amino group in nuclear extracts. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of cancer cells. This antibody specifically targets interferon and growth factor receptors, making it a valuable tool for researchers studying these pathways. In addition, the AK1 antibody has been used in combination with other monoclonal antibodies such as trastuzumab to enhance their therapeutic effects. Its unique lysine-specific binding properties make it an ideal choice for various applications, including spectrometric analysis and electrode-based assays. Whether you are conducting research or developing new therapies, the AK1 antibody is a powerful tool that can help you achieve your goals.TAU antibody
The TAU antibody is a diagnostic agent used in immunochemical studies to detect the presence of TAU protein. It is particularly useful in detecting abnormal levels of TAU protein in human serum, cerebrospinal fluid, and primary neuron cultures. The TAU antibody specifically binds to TAU protein and can be used for the identification and quantification of TAU protein in various biological samples. This monoclonal antibody has high affinity and specificity for TAU protein, making it an excellent tool for research purposes. Whether you're studying synaptic proteins or investigating neurodegenerative diseases characterized by the accumulation of amyloid plaques, the TAU antibody is a valuable asset in your scientific arsenal.Purity:Min. 95%SNRPA antibody
SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen
Purity:Min. 95%ACAD10 antibody
The ACAD10 antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to be effective in various applications. This antibody specifically targets elastase, a protease enzyme involved in numerous biological processes. It has been shown to inhibit elastase activity, thereby preventing its harmful effects on human serum components.Purity:Min. 95%PGDS antibody
PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKISYT3 antibody
SYT3 antibody was raised using the N terminal of SYT3 corresponding to a region with amino acids VSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGG
Purity:Min. 95%PADI4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PADI4 antibody, catalog no. 70R-3322Purity:Min. 95%KHDRBS3 antibody
KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
ANKRD13B antibody
ANKRD13B antibody was raised using the middle region of ANKRD13B corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ
MAK antibody
The MAK antibody is a polyclonal antibody that specifically targets insulin. It is commonly used in research and diagnostic applications to detect and quantify insulin levels in biological samples. The MAK antibody is highly reactive and exhibits high affinity towards insulin, making it an ideal tool for various immunological assays. This antibody can be conjugated with different enzymes such as alkaline phosphatases or horseradish peroxidase, allowing for easy detection of insulin in immunoassays. Additionally, the MAK antibody can be used in combination with other antibodies or binding moieties to develop multiplex assays for the simultaneous detection of multiple analytes. Its versatility and specificity make the MAK antibody a valuable tool in the field of biomedical research and clinical diagnostics.2-Amino-2-[2-(4-nonylphenyl)ethyl]-1,3-propanediol
CAS:Please enquire for more information about 2-Amino-2-[2-(4-nonylphenyl)ethyl]-1,3-propanediol including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H35NO2Purity:Min. 95%Molecular weight:321.5 g/molLoracarbef L-isomer
Loracarbef L-isomer (USP grade powder) chemical reference substancePurity:Min. 95%TNFRSF4 antibody
The TNFRSF4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize chemokines that are activated during viral infections. This antibody has been extensively tested and proven to have antiviral properties, effectively neutralizing virus surface antigens and preventing viral replication.SERPINB3 protein
SERPINB3 protein is a diagnostic agent used in the field of Life Sciences. It is known for its ability to neutralize serine proteases by binding to them, thereby regulating their activity. This protein consists of a chain of amino acids, including specific acid residues that are crucial for its function. SERPINB3 protein has been studied extensively for its potential therapeutic applications, particularly in the field of cancer research. It has been found to be polymorphic, meaning it can exist in different forms or variants within individuals or populations. Monoclonal antibodies targeting SERPINB3 protein have been developed and tested as potential drugs for various conditions. In addition, this protein has shown receptor binding properties and has been investigated as a growth factor in certain biological processes. Its presence in human serum can serve as a biomarker for certain diseases or conditions.Purity:Min. 95%PrP antibody
The PrP antibody is a powerful tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, offering researchers a range of options to suit their specific needs. These antibodies are designed to target and bind to the prion protein (PrP), which plays a crucial role in various biological processes.Purity:Min. 95%ZNF404 antibody
ZNF404 antibody was raised in rabbit using the middle region of ZNF404 as the immunogenPurity:Min. 95%IDI1 antibody
IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAmTOR antibody
The mTOR antibody is a monoclonal antibody that has an inhibitory effect on the mammalian target of rapamycin (mTOR). It is widely used in the industrial and research fields, particularly in Life Sciences. The mTOR antibody works by binding to mTOR and preventing its activation, thereby inhibiting its downstream signaling pathways. This antibody has been extensively studied and characterized using various techniques such as molecular modeling, phosphatase assays, and molecular docking. It is also being explored for its potential as an antidiabetic agent. The mTOR antibody can be immobilized for use in various applications, including diagnostic assays and therapeutic development. With its high specificity and affinity, this monoclonal antibody is a valuable tool for studying the role of mTOR in cellular processes and developing targeted inhibitors.INTS6 antibody
INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKgamma delta TCR antibody (allophycocyanin)
Armenian Hamster monoclonal gamma delta TCR antibody (allophycocyanin)UGT1A9 antibody
UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVPurity:Min. 95%NOTCH1 antibody
NOTCH1 antibody was raised in rabbit using the middle region of NOTCH1 as the immunogenPurity:Min. 95%Cystatin S protein
Cystatin S protein is a factor-α that plays a crucial role in inhibiting proteases, which are enzymes responsible for breaking down proteins. This protein can be conjugated with other molecules to enhance its functionality. Monoclonal antibodies specific to Cystatin S protein have been developed and can be used for research purposes. Cystatin S protein has been shown to inhibit the activity of glial fibrillary acidic protein, which is involved in the formation of glial cells in the central nervous system. It also has an inhibitory effect on interleukin-6, a cytokine involved in inflammation. Studies have demonstrated that Cystatin S protein can bind to cellulose, suggesting potential applications in the field of biomaterials. Additionally, it has been found to have reactive properties against interferon and exhibits neutralizing effects on certain factors present in human serum and adipose tissue.Purity:Min. 95%SELENBP1 antibody
SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRNPFF1 antibody
NPFF1 antibody was raised in rabbit using N terminal sequence MEGEPSQPPNSSWPLS and C terminal sequence CSHLPLTIPAWDI of the human NPFF1 protein as the immunogen.
Purity:Min. 95%ALG11 antibody
ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAPurity:Min. 95%ZGPAT antibody
ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEFSH3GL2 antibody
SH3GL2 antibody was raised using the N terminal of SH3GL2 corresponding to a region with amino acids INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAPurity:Min. 95%EDTA plasma
EDTA plasma is a type of sample used in Life Sciences research and drug development. It contains inhibitors, such as teriparatide and TNF-α neutralizing agents, which are commonly used in experiments involving drug antibodies. EDTA plasma is particularly useful for studying fibrinogen levels, monoclonal antibodies, and binding proteins. In research settings, EDTA plasma is often employed to measure phosphatase activity and evaluate the effects of alpha-gal antibodies. This type of plasma is widely used in Biospecimen studies as it allows for the analysis of various biomarkers, including those found in human serum and other bodily fluids. Overall, EDTA plasma serves as a valuable resource for scientists and researchers looking to study the intricate details of biological processes and develop new therapies or diagnostic tools. Its unique composition enables accurate measurements and precise analysis, making it an essential component in many scientific investigations.Purity:Min. 95%mTOR antibody
The mTOR antibody is a highly specialized monoclonal antibody that targets the phosphatase known as mammalian target of rapamycin (mTOR). This glycoprotein plays a crucial role in regulating cell growth, proliferation, and survival. By specifically binding to mTOR, this antibody inhibits its activity and disrupts downstream signaling pathways involved in cell cycle progression and protein synthesis.
PCT monoclonal antibody
The PCT monoclonal antibody is a neutralizing protein used in the field of Life Sciences. It is an antibody that specifically targets and binds to urokinase plasminogen activator (uPA), inhibiting its activity. By blocking uPA, this antibody helps regulate thrombocytopenia, a condition characterized by low platelet levels. Additionally, the PCT monoclonal antibody exhibits cytotoxic effects on cells expressing high levels of uPA, making it a potential therapeutic option for certain diseases. This monoclonal antibody can also be used in research settings to study the role of uPA in various biological processes and as a diagnostic tool to measure uPA levels in patient samples. With its ability to target and modulate the activity of this important growth factor, the PCT monoclonal antibody holds promise as a medicament for various conditions involving aberrant uPA signaling pathways.Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.RGS6 antibody
RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYPurity:Min. 95%Cytokeratin 18 antibody
The Cytokeratin 18 antibody is a specific antibody used in Life Sciences research. It is commonly used to detect and measure the levels of Cytokeratin 18, a protein that is found in epithelial cells. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. It has been shown to have high affinity and specificity for Cytokeratin 18, making it a valuable tool for studying the function and expression of this protein. The Cytokeratin 18 antibody can also be used to study diseases such as cancer, where abnormal levels of Cytokeratin 18 may be present. Overall, this antibody is an essential tool for researchers working in the field of Life Sciences.
![2-Amino-2-[2-(4-nonylphenyl)ethyl]-1,3-propanediol](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FWEB59444.webp&w=3840&q=75)
