Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,674 products)
- By Biological Target(100,192 products)
- By Pharmacological Effects(6,848 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(355 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130274 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KSHV ORF26 antibody
KSHV ORF26 antibody was raised in Mouse using a purified recombinant fragment of KSHV ORF26 expressed in E. coli as the immunogen.SIL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIL1 antibody, catalog no. 70R-7154Purity:Min. 95%nNOS antibody
The nNOS antibody is a highly specialized cytotoxic antibody used in the field of Life Sciences. It is an essential tool for researchers studying various cellular processes, such as phosphatase activity and epidermal growth factor (EGF)-like signaling pathways. This monoclonal antibody specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. By blocking the activity of nNOS, this antibody can modulate important cellular functions, including chemokine production and growth factor signaling.CALML5 antibody
The CALML5 antibody is a substance used in the field of Life Sciences for various applications. It is an antigen that can be used for gas-liquid interface studies and has been shown to interact with lyso-gb1, a molecule involved in antinociceptive responses. The CALML5 antibody can be used in research experiments to detect and analyze the presence of CALML5 in samples. It is also commonly used as a tool in vaccine development and as an inhibitor in studies involving pluripotent stem cells. Additionally, this antibody has been explored for its potential therapeutic applications, such as being an HDAC inhibitor or targeting collagen-related disorders.RPS21 antibody
RPS21 antibody was raised using the middle region of RPS21 corresponding to a region with amino acids NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF
SOX4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SOX4 antibody, catalog no. 70R-7975Purity:Min. 95%CPSF3 antibody
CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALNMDAR2B antibody
The NMDAR2B antibody is a polyclonal antibody that targets the N-methyl-D-aspartate receptor subunit 2B (NMDAR2B). This antibody specifically binds to annexin A2, insulin, alpha-fetoprotein, and pancreatic glucagon. It can be used in various life science research applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). The NMDAR2B antibody is available as both polyclonal and monoclonal antibodies and is suitable for use in human serum samples. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of NMDAR2B in various biological processes.
Purity:Min. 95%EIF4G3 antibody
EIF4G3 antibody was raised using the N terminal of EIF4G3 corresponding to a region with amino acids TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA
EIF4ENIF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4ENIF1 antibody, catalog no. 70R-3586Purity:Min. 95%ETK antibody
The ETK antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to specific proteins, such as interferon and colony-stimulating factors, which play crucial roles in various biological processes. This antibody can be used for a range of applications, including antiviral research, studying the effects of growth factors on cell proliferation and differentiation, and investigating the role of chemokines in immune responses.
GABARAPL1 antibody
GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTITBL3 antibody
TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILPurity:Min. 95%BLK antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.CRP protein
The CRP protein, also known as C-reactive protein, is a vital component in the body's immune response. It plays a crucial role in thrombotic microangiopathy and is involved in various biological processes. This protein has been extensively studied and has shown promising results in different medical fields.Purity:Min. 95%SGK2 antibody
The SGK2 antibody is a highly specialized monoclonal antibody that targets the SGK2 protein. This protein is involved in various cellular processes, including the regulation of lipoprotein lipase activity and cation channel function. The SGK2 antibody has been extensively tested in Life Sciences research and has shown excellent specificity and sensitivity in detecting SGK2 in various experimental settings.
AP3S1 antibody
AP3S1 antibody was raised in rabbit using the C terminal of AP3S1 as the immunogenPurity:Min. 95%Nptx1 antibody
Nptx1 antibody was raised in rabbit using the middle region of Nptx1 as the immunogenPurity:Min. 95%ZNF300 antibody
ZNF300 antibody was raised in rabbit using the N terminal of ZNF300 as the immunogenPurity:Min. 95%SMAD2 antibody
The SMAD2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the SMAD2 protein, which plays a crucial role in signal transduction pathways involved in cell growth, differentiation, and development. By binding to SMAD2, this antibody inhibits its activation and downstream signaling events.Filamin A antibody
The Filamin A antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists studying various aspects of cell biology and protein interactions. This antibody specifically targets Filamin A, a protein that plays a crucial role in cell adhesion, cytoskeleton organization, and signal transduction.EIF5A2 antibody
EIF5A2 antibody was raised using the N terminal of EIF5A2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK
CDH1 antibody
CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDPurity:Min. 95%Chromogranin A antibody
The Chromogranin A antibody is a highly specialized drug antibody that targets the growth factor chromogranin A. It is available in both monoclonal and polyclonal forms, providing a wide range of options for researchers in the Life Sciences field. This antibody specifically binds to chromogranin A, preventing its interaction with other binding proteins and interfering with its function. By targeting this growth factor, the Chromogranin A antibody can be used to study various biological processes, including the regulation of interleukins and messenger RNA. It is commonly used in research settings to investigate the role of chromogranin A in enteroendocrine cells and to develop novel therapeutic approaches using chimeric proteins. With its high specificity and effectiveness, this antibody is an essential tool for scientists studying chromogranin A-related mechanisms and pathways.Latexin protein
1-222 amino acids: MEIPPTNYPA SRAALVAQNY INYQQGTPHR VFEVQKVKQA SMEDIPGRGH KYRLKFAVEE IIQKQVKVNC TAEVLYPSTG QETAPEVNFT FEGETGKNPD EEDNTFYQRL KSMKEPLEAQ NIPDNFGNVS PEMTLVLHLA WVACGYIIWQ NSTEDTWYKM VKIQTVKQVQ RNDDFIELDY TILLHNIASQ EIIPWQMQVL WHPQYGTKVK HNSRLPKEVQ LEPurity:Min. 95%Rabbit anti Goat IgG Fc (rhodamine)
This antibody reacts with heavy chains on Goat IgG.Purity:Min. 95%KIF2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF2A antibody, catalog no. 70R-5539Purity:Min. 95%LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody that targets the TGF-beta-activated kinase 1 (LIMK1) protein. This antibody has been extensively studied for its cytotoxic effects on various cell types, particularly in relation to endothelial growth and angiogenesis. It has shown promising results in inhibiting the growth of tumor cells by blocking the activity of LIMK1.CD4 antibody (FITC)
CD4 antibody (FITC) was raised in mouse using P815 cell transfected with human CD4 as the immunogen.MAGEA9 antibody
MAGEA9 antibody was raised in rabbit using the N terminal of MAGEA9 as the immunogenPurity:Min. 95%p70S6 Kinase antibody
The p70S6 Kinase antibody is a highly specialized monoclonal antibody that targets the disulfide bond of the p70S6 kinase protein. This antibody has been extensively tested and proven to be cytotoxic, leading to the lysis of cells expressing high levels of p70S6 kinase. It has also been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and cell death.
Purity:Min. 95%RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It acts as a growth factor and has been shown to inhibit hepatocyte growth. This antibody can be used for various applications, including research and therapeutic purposes. It has been found to have cytotoxic effects on cancer cells, such as MCF-7, and can also enhance the efficacy of other anticancer drugs. The RARG antibody binds specifically to RARG and modulates its activity, affecting downstream signaling pathways involved in cell proliferation, differentiation, and apoptosis. It has also been shown to interact with other proteins, such as fibronectin and lipoprotein lipase. This versatile antibody is a valuable tool for studying the role of RARG in various biological processes and may have potential applications in cancer treatment.SPATA2L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA2L antibody, catalog no. 70R-3641
Purity:Min. 95%Rabbit anti Sheep IgG
Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(c) fragment as the immunogen.
Purity:Min. 95%CYB5R3 antibody
The CYB5R3 antibody is a polyclonal antibody that plays a crucial role in various cholinergic and growth factor-related processes in Life Sciences. It is commonly used in research to study the cytotoxic effects of certain compounds on liver microsomes and dopamine metabolism. The CYB5R3 antibody specifically targets and binds to activated CYB5R3, an enzyme involved in electron transfer reactions. This binding inhibits the enzymatic activity of CYB5R3, leading to a decrease in the production of reactive oxygen species and neuroprotective effects. Additionally, this antibody has been shown to inhibit the expression of interleukin-6, a pro-inflammatory cytokine. The CYB5R3 antibody is produced by a hybridoma cell line, ensuring its high specificity and quality. Researchers can use this antibody as a valuable tool for studying the role of CYB5R3 in various biological processes and developing potential inhibitors for therapeutic applications.BCL2 antibody
The BCL2 antibody is a powerful cytotoxic agent that targets the growth of endothelial cells. It acts as a monoclonal antibody, specifically binding to the BCL2 protein and inhibiting its function. This antibody has been shown to have high affinity and specificity for its target molecule, making it an effective tool for research and therapeutic applications.
FOG2 antibody
The FOG2 antibody is an extracellular serum marker that plays a crucial role in the regulation of fetal hemoglobin. It is widely used in Life Sciences research and diagnostics. This polyclonal antibody specifically targets dopamine, serotonin, and aminoacyl neurotransmitters, making it an essential tool for studying their functions and interactions. Additionally, the FOG2 antibody has been utilized as a therapeutic agent in the treatment of various diseases by acting as an inhibitor of zinc chelators and autoantibodies. Its high specificity and affinity make it a valuable tool for scientists and medical professionals alike.ZNF783 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF783 antibody, catalog no. 70R-8871Purity:Min. 95%FAM83F Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM83F antibody, catalog no. 70R-3972Purity:Min. 95%OR2C3 antibody
OR2C3 antibody was raised in rabbit using the C terminal of OR2C3 as the immunogenPurity:Min. 95%HAPLN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAPLN1 antibody, catalog no. 70R-6065Purity:Min. 95%ORC4L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ORC4L antibody, catalog no. 70R-5589Purity:Min. 95%ZNF587 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF587 antibody, catalog no. 70R-8393
Purity:Min. 95%RAB11A protein (His tag)
1-213 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMGTR DDEYDYLFKV VLIGDSGVGK SNLLSRFTRN EFNLESKSTI GVEFATRSIQ VDGKTIKAQI WDTAGQERYR AITSAYYRGA VGALLVYDIA KHLTYENVER WLKELRDHAD SNIVIMLVGN KSDLRHLRAV PTDEARAFAE KNGLSFIETS ALDSTNVEAA FQTILTEIYR IVSQKQMSDR RENDMSPSNN VVPIHVPPTT ENKPKVQCCPurity:Min. 95%CPXCR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 70R-8397Purity:Min. 95%MBP antibody
MBP antibody was raised in mouse using recombinant MBP purified from E. coli as the immunogen.Cingulin antibody
Cingulin antibody was raised in mouse using a synthetic peptide corresponding to residues 4-24 of cingulin as the immunogen.FOS antibody
FOS antibody was raised in mouse using recombinant Human V-Fos Fbj Murine Osteosarcoma Viral Oncogene HomologNQO1 Antibody
The NQO1 Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and detects NQO1, an enzyme that plays a crucial role in cellular defense against oxidative stress. It has been extensively studied for its potential as a biomarker in various diseases, including cancer.
PRCP antibody
The PRCP antibody is a highly specialized antibody used in the field of Life Sciences. It is an autoantibody that specifically targets and binds to the PRCP protein, which plays a crucial role in various cellular processes. This antibody is commonly used for research purposes in laboratories and academic institutions.p300 antibody
The p300 antibody is a highly specific and potent monoclonal antibody that is widely used in Life Sciences research. It has been extensively validated for its high specific activity and neutralizing capabilities. The p300 antibody binds to alpha-fetoprotein, interferon, annexin, and annexin A2 with exceptional affinity, making it an ideal tool for various assays and experiments. Researchers rely on the p300 antibody to study the role of these molecules in different biological processes. Additionally, this antibody has shown promising results in detecting superoxide levels and fatty acid metabolism. Whether you are studying protein-protein interactions or investigating cellular pathways, the p300 antibody is an indispensable tool for your research needs.Trypsin antibody
Trypsin antibody was raised in mouse using purified human pancreatic trypsin as the immunogen.RCC2 antibody
RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTHepatitis C Virus Nucleocpasid Genotype 2a protein
The E.coli derived recombinant protein contains the HCV NS5 Genotype1a immunodominant regions, amino acids 2322-2423 having a total molecular weight of 38.34 kDa which includes a 26 kDa GST tag.Purity:Min. 95%GNB1 antibody
GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRabbit anti Rat IgG (FITC)
Rabbit anti-rat IgG (FITC) was raised in rabbit using rat IgG F(c) fragment as the immunogen.Purity:Min. 95%Collagen Type VI protein
Collagen Type VI protein is a pegylated monoclonal antibody that belongs to the family of Proteins and Antigens. It is commonly used in Life Sciences for various research purposes. This protein has been shown to be activated by alpha-fetoprotein and acts as a kinase inhibitor. Collagen Type VI protein is native to the human body and plays a crucial role in maintaining the structural integrity of tissues. It interacts with phalloidin, which stabilizes actin filaments, providing support to cells. Additionally, this protein has been studied in multidrug resistance and its impact on creatine kinase levels in human serum. Its glycation properties make it a valuable tool for studying advanced glycation end products (AGEs) and their effects on cellular function.Purity:Min. 95%Gentamycin antibody
The Gentamycin antibody is a monoclonal antibody that has been developed to target and neutralize the effects of Gentamycin, a commonly used antibiotic. This antibody specifically binds to Gentamycin, preventing it from interacting with its target receptors and inhibiting its antibacterial activity.
Purity:Min. 95%OTUB2 antibody
OTUB2 antibody was raised in rabbit using the N terminal of OTUB2 as the immunogenPurity:Min. 95%USP3 antibody
USP3 antibody was raised in rabbit using the N terminal of USP3 as the immunogenPurity:Min. 95%Septin 11 antibody
Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETPurity:Min. 95%C4ORF22 antibody
C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
Osteopontin antibody
The Osteopontin antibody is a glycoprotein that has cytotoxic effects and interferes with the function of serine protease inhibitors. It is a type of monoclonal antibody that specifically targets osteopontin, a protein involved in various biological processes. This antibody has been shown to neutralize the activity of osteopontin, inhibiting its function and potentially preventing its involvement in disease progression. The Osteopontin antibody is commonly used in life sciences research and has shown promising results in studies related to cancer, inflammation, and other pathological conditions. With its ability to target specific molecules, this antibody offers great potential for therapeutic applications in the future.
