Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,678 products)
- By Biological Target(100,149 products)
- By Pharmacological Effects(6,845 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,910 products)
- Secondary Metabolites(14,344 products)
Found 130210 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RAD9B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD9B antibody, catalog no. 70R-5622Purity:Min. 95%KIF23 antibody
KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQPurity:Min. 95%TUSC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC1 antibody, catalog no. 70R-2591Purity:Min. 95%Irx6 antibody
Irx6 antibody was raised in rabbit using the middle region of Irx6 as the immunogenPurity:Min. 95%RNASE9 antibody
RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNHWNT9B antibody
WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA
Purity:Min. 95%SPZ1 antibody
SPZ1 antibody was raised in rabbit using the C terminal of SPZ1 as the immunogenPurity:Min. 95%Mcm10 antibody
Mcm10 antibody was raised in rabbit using the N terminal of Mcm10 as the immunogenPurity:Min. 95%IKB alpha antibody
The IKB alpha antibody is a polyclonal antibody used in Life Sciences for various applications. It is designed to target the epidermal growth factor and has been widely used in research studies. This antibody can be used to detect autoantibodies and glucan synthase in pharmaceutical preparations. With its high specificity and sensitivity, it is an essential tool for studying cell antibodies and low-molecular-weight chimeric proteins. The IKB alpha antibody is available as a monoclonal antibody, making it an ideal choice for researchers looking for a reliable medicament. Its ability to target growth factors and localize to the apical membrane makes it suitable for a wide range of experiments. Trust the IKB alpha antibody to deliver accurate and reproducible results in your research endeavors.Purity:Min. 95%Angiopoietin 2 antibody
Angiopoietin 2 antibody was raised in rabbit using a synthetic peptide corresponding to a region of mouse Angiopietin-2 protein conjugated to KLH as the immunogen.Purity:Min. 95%XAB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XAB2 antibody, catalog no. 70R-8952Purity:Min. 95%PSMC3IP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC3IP antibody, catalog no. 70R-8725Purity:Min. 95%CD25 antibody
CD25 antibody was raised in rat using IL-2-dependent BALB/c murine helper T-cell as the immunogen.
CDH12 antibody
CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI
Purity:Min. 95%USP20 antibody
USP20 antibody was raised in rabbit using the middle region of USP20 as the immunogenPurity:Min. 95%PGM1 antibody
The PGM1 antibody is a highly specialized antibody that targets elastase and annexin A2. It is commonly used in life sciences research, particularly in the field of insulin studies. This antibody has been extensively tested and proven to be effective in detecting insulin and its related proteins in various samples, including human serum and tissue samples.PRTFDC1 antibody
PRTFDC1 antibody was raised using the middle region of PRTFDC1 corresponding to a region with amino acids MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYAFEM1B antibody
FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVREPurity:Min. 95%LAT3 antibody
LAT3 antibody is a monoclonal antibody that is used as a medicament in the field of Life Sciences. It specifically targets arginase, an enzyme involved in the metabolism of arginine. By blocking the activity of arginase, LAT3 antibody helps to regulate the levels of arginine in the body, which can have various biochemical effects. This antibody has been extensively studied and characterized using hybridoma cell lines and isolated nucleic acids. It has shown high affinity for its target and exhibits excellent specificity for human proteins. LAT3 antibody is widely used in research laboratories and pharmaceutical companies for a variety of applications, including protein analysis, immunohistochemistry, and drug development. Whether you need a monoclonal or polyclonal antibody, LAT3 antibody is a reliable choice that delivers consistent results.CADM1 antibody
The CADM1 antibody is a high-quality antibody used in various immunocytochemical studies. It specifically targets the human protein CADM1, which plays a crucial role in cell adhesion and signaling. This antibody is produced using recombinant protein technology, ensuring its specificity and reliability.PINX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PINX1 antibody, catalog no. 70R-2144
Purity:Min. 95%Raf1 antibody
The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.
BAK1 antibody
BAK1 antibody was raised in mouse using recombinant human BAK1 (29-187aa) purified from E.coli as the immunogen.SOX17 antibody
The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.FLJ10490 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ10490 antibody, catalog no. 70R-9475Purity:Min. 95%SF3B3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4646Purity:Min. 95%Hamster RBC antibody (FITC)
Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.
PHLDA2 antibody
PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTPurity:Min. 95%LDLRAD1 antibody
LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPPurity:Min. 95%PARP16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6276Purity:Min. 95%HSPA9 antibody
The HSPA9 antibody is a powerful tool in the field of Life Sciences. It targets the HSPA9 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to epidermal growth factor, erythropoietin, e-cadherin, ketanserin, trastuzumab, and anti-HER2 antibody.PH4 antibody
PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHPurity:Min. 95%HSPA9 antibody
HSPA9 antibody was raised in rabbit using the C terminal of HSPA9 as the immunogenPurity:Min. 95%KCTD10 antibody
KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRIGoat anti Mouse IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%ZNF276 antibody
ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogenPurity:Min. 95%SERPINB2 antibody
The SERPINB2 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of human serum, including fatty acid metabolism, glutamate signaling, growth factors, and angiogenesis. This monoclonal antibody has been specifically designed to target and bind to SERPINB2, a protein involved in regulating several important biological processes.TIM antibody
The TIM antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which plays a crucial role in cell proliferation and differentiation. The TIM antibody can be used in research related to heparin-induced thrombocytopenia, where it helps in identifying and studying the mechanisms involved in this condition.MAGEA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA4 antibody, catalog no. 70R-4207Purity:Min. 95%CEBPZ antibody
CEBPZ antibody was raised in rabbit using the middle region of CEBPZ as the immunogenPurity:Min. 95%DDX47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-1369Purity:Min. 95%NPM1 antibody
The NPM1 antibody is a diagnostic reagent used in Life Sciences. It belongs to the group of antibodies that target annexin A2, which is a protein involved in various cellular processes. This antibody specifically recognizes and binds to annexin A2, making it a valuable tool for research and diagnostic purposes. Additionally, the NPM1 antibody can be used in recombinant cells to study the function of annexin A2 and its binding partners. It can also be used as a therapeutic agent or as part of a medicament for the treatment of diseases related to annexin A2 dysregulation. With its high specificity and affinity, this monoclonal antibody offers great potential in advancing scientific knowledge and improving patient care.IgG2a Isotype Control Fc fusion protein (FITC)
Rat monoclonal IgG2a Isotype Control Fc fusion protein (FITC)Purity:Min. 95%LIPH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LIPH antibody, catalog no. 70R-10356
Purity:Min. 95%CLUAP1 antibody
CLUAP1 antibody was raised in rabbit using the C terminal of CLUAP1 as the immunogenPurity:Min. 95%SLAMF6 antibody
SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTPurity:Min. 95%Oct 3/4 antibody
Oct 3/4 antibody was raised in rabbit using an internal sequence of the human Oct 3/4 protein as the immunogen.
Purity:Min. 95%IL31 antibody
IL31 antibody was raised in rabbit using highly pure recombinant human IL-31 as the immunogen.Purity:Min. 95%BACE2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BACE2 antibody, catalog no. 70R-6559Purity:Min. 95%KCNA1 antibody
KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Purity:Min. 95%Ezrin antibody
The Ezrin antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is an essential tool for researchers in the Life Sciences field, particularly those studying cell signaling pathways and protein interactions.Caveolin 1 antibody
The Caveolin 1 antibody is a powerful tool used in Life Sciences research. It specifically targets Caveolin 1, a protein found in mesenchymal stem cells, and has been shown to have various applications in the field.
