Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
NIP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NIP7 antibody, catalog no. 70R-1412Purity:Min. 95%HSV1 antibody (HRP)
HSV1 antibody (HRP) was raised in goat using HSV type 1, strain F as the immunogen.Rabbit anti Rat IgM (FITC)
Rabbit anti-rat IgM (FITC) was raised in rabbit using rat IgM mu chain as the immunogen.Purity:Min. 95%EMID1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EMID1 antibody, catalog no. 70R-7323Purity:Min. 95%SUZ12 antibody
The SUZ12 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets SUZ12, a protein involved in gene regulation and chromatin remodeling. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.PGM3 antibody
PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLHGF antibody (biotin)
HGF antibody (biotin) was raised in goat using S. frugiperda insect ovarian cell line Sf 21-derived recombinant human HGF as the immunogen.GPN2 antibody
GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNACP1 antibody
ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATPH2 antibody
TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
FER1L3 antibody
FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMPurity:Min. 95%URP1 antibody
URP1 antibody was raised in rabbit using residues 643-660 (VHEYIGGYIFLSTRSKDQ) of the 77 kDa human URP1 protein as the immunogen.Purity:Min. 95%EIF1AY antibody
The EIF1AY antibody is a highly specialized antibody used in life sciences research. It is a polyclonal antibody that specifically targets the EIF1AY protein, which is an important biomarker in various biological processes. This antibody is designed to detect and bind to the EIF1AY protein, allowing researchers to study its expression and function in different cell types and tissues. With its high specificity and sensitivity, the EIF1AY antibody is an invaluable tool for scientists studying gene expression, protein synthesis, and other cellular mechanisms. Whether you're conducting basic research or working on drug development, this antibody can provide valuable insights into the intricate workings of biological systems.EGFR antibody
The EGFR antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying the epidermal growth factor receptor (EGFR) and its role in cellular signaling pathways. This monoclonal antibody specifically targets and binds to the activated form of EGFR, inhibiting its function and downstream signaling.CRLF2 antibody
The CRLF2 antibody is a medicine that belongs to the class of Monoclonal Antibodies. It works by blocking the emission of certain signals in the body, which can help in the treatment of various conditions. This antibody specifically targets caveolin-1, a protein involved in cell signaling and regulation. By inhibiting caveolin-1, the CRLF2 antibody can interfere with the condensation of certain molecules and prevent their activity.ALDH3A2 antibody
ALDH3A2 antibody was raised using the C terminal of ALDH3A2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGPurity:Min. 95%ALDH1L1 antibody
The ALDH1L1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the ALDH1L1 antigen, which is involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.IL10 antibody
The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.
Resistin protein
Region of Resistin protein corresponding to amino acids SSKTLCSMEE AINERIQEVA GSLIFRAISS IGLECQSVTS RGDLATCPRG FAVTGCTCGS ACGSWDVRAE TTCHCQCAGM DWTGARCCRV QP.Purity:Min. 95%S 38093-2
CAS:S 38093-2 is a selective dopamine D1 receptor agonist with low affinity for dopamine D2 receptors. It has been shown to possess antinociceptive properties in animal models and may act on the transmission of norepinephrine and dopamine in the central nervous system. In clinical studies, S 38093-2 has been found to have no significant adverse effects on plasma concentrations of norepinephrine or dopamine. S 38093-2 has shown efficacy in the treatment of neuropathic pain in animals, which is not surprising due to its binding profile. The drug also showed an ability to reduce depression-like behaviors in mice with chronic unpredictable stress and exhibited good oral bioavailability in rats. S 38093-2 also has a potential use as a treatment for Parkinson's disease due to its ability to inhibit the activity of dopamine transporter proteins.
Formula:C17H24N2O2·HClPurity:Min. 95%Molecular weight:324.85 g/molZNF529 antibody
ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogenPurity:Min. 95%SMR3A antibody
SMR3A antibody was raised using the middle region of SMR3A corresponding to a region with amino acids YGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPPurity:Min. 95%Rab10 antibody
Rab10 antibody was raised in rabbit using the C terminal of Rab10 as the immunogenPurity:Min. 95%TOM1 antibody
TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGASYK-IN-1
CAS:SYK-IN-1 is a peptide that has been shown to activate the protein tyrosine kinase SYK. It also inhibits the phosphorylation of the receptor, which leads to reduced signaling through this pathway. SYK-IN-1 can be used as a research tool and is available in high purity. This peptide binds to the ligand of receptor with high affinity and specificity. SYK-IN-1 is a potent inhibitor of protein interactions, specifically those between Ligands and Receptors. CAS No: 1491150-77-6
Formula:C18H22N8OPurity:Min. 95%Molecular weight:366.4 g/molSNRPB antibody
SNRPB antibody was raised using the middle region of SNRPB corresponding to a region with amino acids LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPGa11
CAS:Ga11 is a mutant strain of Saccharomyces cerevisiae that has been engineered to synthesize lactic acid. Ga11 has the ability to produce lactic acid in an aqueous environment with an acidic pH, which is a desirable trait for industrial applications. The regulatory domain of Ga11 is not active at the same time as its enzyme activities, leading to asymmetric synthesis and reduced production rates. This strain can be used for the diagnosis of autoimmune diseases, as well as for the production of chiral compounds such as pharmaceuticals and monoclonal antibodies.
Formula:C19H14N2Purity:Min. 95%Molecular weight:270.3 g/molTNFRSF11B antibody
TNFRSF11B antibody was raised in rabbit using the N terminal of TNFRSF11B as the immunogenPurity:Min. 95%TACI protein
Region of TACI protein corresponding to amino acids MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL PGLKLSADQV.Purity:Min. 95%ACLY Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACLY antibody, catalog no. 70R-3942Purity:Min. 95%IGF1R antibody
The IGF1R antibody is a highly specialized product in the field of Life Sciences. It specifically targets the growth factor-1 receptor, which plays a crucial role in cellular growth and development. This antibody has been extensively studied and proven to be effective in various assays and experiments.3-Amino-1-propanol-d4
CAS:Please enquire for more information about 3-Amino-1-propanol-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C3H9NOPurity:Min. 95%Molecular weight:79.13 g/molAZD-0284
CAS:AZD-0284 is a small molecule that inhibits the transcriptional activity of nuclear receptors. It has shown efficacy in animal models of autoimmune disease and is currently being studied in human clinical trials for treatment of psoriasis. AZD-0284 binds to the ligand binding region at the N-terminus of nuclear receptor DNA-binding domain, preventing it from binding to DNA and initiating transcription. The compound has been shown to inhibit interleukin (IL)-17 production in an IL-17 knockout mouse model. Effects on IL-17 levels were associated with decreased severity of inflammatory skin diseases such as atopic dermatitis, psoriasis, and allergic contact dermatitis.Formula:C21H18F6N2O5SPurity:Min. 95%Molecular weight:524.4 g/molFkbp12 protac rc32
CAS:FKBP12 PROTAC RC32 is an innovative anticancer drug that works by inhibiting kinase activity in cancer cells. It is a potent inhibitor of the cell cycle, inducing apoptosis and halting tumor growth. FKBP12 PROTAC RC32 has been shown to be effective in human cancer cell lines, with analogs found in urine samples of patients undergoing chemotherapy. This medicinal compound targets specific kinases involved in cancer development and progression, making it a promising option for targeted therapy. Its unique protein degradation mechanism allows for selective elimination of target proteins, reducing off-target effects commonly seen with traditional inhibitors. Overall, FKBP12 PROTAC RC32 shows great potential as a powerful tool in the fight against cancer.Formula:C75H107N7O20Purity:Min. 95%Molecular weight:1,426.7 g/molMK 0557
CAS:Neuropeptide Y5 (NPY5) receptor antagonistFormula:C22H19FN4O3Purity:Min. 95%Molecular weight:406.41 g/molND2 antibody
The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.
3,6-Dimethyl-4-pentan-3-yloxy-2-(2,4,6-trimethylphenoxy)pyridine
CAS:3,6-Dimethyl-4-pentan-3-yloxy-2-(2,4,6-trimethylphenoxy)pyridine is a drug that binds to the corticotropin releasing factor receptor (CRF) and the receptor for depression. This drug has been shown to be effective in clinical studies of depression and psychotic disorders. 3,6-Dimethyl-4-pentan-3-yloxy-2-(2,4,6-trimethylphenoxy)pyridine is a hydrogen bond donor and has a carbonyl group as one of its functional groups. This drug is used as a diluent in pharmaceuticals. 3,6 -Dimethyl -4 pentan -3 yloxy -2 ( 2, 4, 6 trim ethyl phenoxy ) pyridine has an acceptor group that can react with an electron pair donor such as oxygen. This drug also has properties that allow it to be
Formula:C21H29NO2Purity:Min. 95%Molecular weight:327.5 g/molMEK5 antibody
The MEK5 antibody is a monoclonal antibody that targets the MEK5 protein, which is involved in cell growth and survival. It has been shown to inhibit the growth of microvessels by blocking the activity of growth factors such as epidermal growth factor (EGF). This antibody specifically binds to the MEK5 protein, preventing its interaction with downstream signaling molecules and inhibiting cell proliferation. Additionally, the MEK5 antibody has been found to have cytotoxic effects on granulosa cells, potentially making it a promising therapeutic option for conditions involving abnormal cell growth. Its specificity and ability to target specific proteins make it a valuable tool in life sciences research.Purity:Min. 95%ERBB4 antibody
ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%GPR182 antibody
GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%KIR2DL1 antibody
KIR2DL1 antibody was raised in mouse using recombinant human kIR2DL1 (23-223 aa) purified from E. coli as the immunogen.
NANP antibody
NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%HS56
CAS:HS56 is an advanced biopolymer, which is derived from a proprietary synthesis of renewable sources. With its unique molecular configuration, this product stands out due to its sustainable origin and innovative production method. The mode of action involves its ability to form stable complexes with diverse substrates, which can enhance material properties such as strength, flexibility, and biodegradability.
Formula:C13H8ClN5OSPurity:Min. 95%Molecular weight:317.75 g/molIL1a antibody
IL1a antibody is a monoclonal antibody that specifically targets interleukin-1 alpha (IL-1α), a pro-inflammatory cytokine involved in various immune responses. This antibody can be used for research purposes in the field of life sciences to study the role of IL-1α in different biological processes. IL1a antibody has been shown to inhibit the activity of IL-1α, preventing its interaction with its receptors and subsequent signaling pathways. It can also be used as a therapeutic agent to treat conditions associated with excessive IL-1α activity, such as inflammatory diseases or autoimmune disorders. The high specificity and affinity of this monoclonal antibody make it a valuable tool for scientists and researchers working in immunology, pharmacology, and related fields.TRIM33 antibody
The TRIM33 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to TRIM33 protein, which plays a crucial role in cellular processes. The antibody is made using advanced techniques and high-quality materials to ensure its effectiveness.
EPHB4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth. With its potent properties and mechanisms of action, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside offers a promising solution for combating tuberculosis infections.Purity:Min. 95%HAV VP3 antibody
The HAV VP3 antibody is a monoclonal antibody that has neutralizing properties. It belongs to the class of antibodies known as monoclonal antibodies, which are specifically designed to target and neutralize specific antigens. This antibody is particularly effective in neutralizing the hepatitis A virus (HAV) by binding to its VP3 protein component.K252a
CAS:Inhibitor of TRK family of kinasesFormula:C27H21N3O5Purity:Min. 95%Molecular weight:467.47 g/molVASP antibody
The VASP antibody is a powerful cytotoxic agent that is used in the treatment of thrombocytopenia, a condition characterized by low platelet count. This antibody specifically targets and destroys antibodies that are responsible for the destruction of platelets. By neutralizing these harmful antibodies, the VASP antibody helps to restore normal platelet levels and improve overall blood clotting function.KRT19 antibody
The KRT19 antibody is a highly specific monoclonal antibody that targets the carboxyl terminal of Keratin 19 (KRT19). It is commonly used in various life science research applications, including hybridization studies, immunohistochemistry, and Western blotting. The antibody shows strong reactivity with KRT19 and has been validated for use in multiple species.CCR7 antibody
The CCR7 antibody is a potent tool used in Life Sciences research. It specifically targets the CCR7 protein, which is involved in various biological processes such as erythropoietin production and endothelial growth. This antibody binds to the CCR7 protein, preventing its interactions with other binding proteins and inhibiting its function.FLT3 antibody
The FLT3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the FLT3 protein, which plays a crucial role in cell growth and survival. The antibody recognizes and binds to specific acid residues on the FLT3 protein, leading to its neutralization and inhibition of its function.FNDC4 antibody
FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSPurity:Min. 95%BRS3 antibody
BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Vimentin antibody
Vimentin antibody was raised in guinea pig using vimentin purified from calf lens as the immunogen.Purity:Min. 95%PPIF antibody
PPIF antibody was raised in mouse using recombinant human PPIF (30-207aa) purified from E. coli as the immunogen.EIF4A3 antibody
EIF4A3 antibody was raised in rabbit using the N terminal of EIF4A3 as the immunogenPurity:Min. 95%AVIL antibody
AVIL antibody was raised in rabbit using the middle region of AVIL as the immunogenPurity:Min. 95%ZNF683 antibody
ZNF683 antibody was raised in rabbit using the N terminal of ZNF683 as the immunogen
Purity:Min. 95%TP53INP1 antibody
TP53INP1 antibody was raised in rabbit using the C terminal of TP53INP1 as the immunogenPurity:Min. 95%Clcn1 antibody
Clcn1 antibody was raised in rabbit using the C terminal of Clcn1 as the immunogenPurity:Min. 95%
