Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,937 products)
- By Biological Target(100,608 products)
- By Pharmacological Effects(6,817 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,771 products)
- Secondary Metabolites(14,352 products)
Found 130623 products of "Biochemicals and Reagents"
ANXA10 antibody
The ANXA10 antibody is a highly effective immunological tool used in Life Sciences research. It is available in both polyclonal and monoclonal forms, making it versatile for various applications. This antibody specifically targets ANXA10, also known as Annexin A10, which plays a crucial role in cellular processes such as cell signaling and membrane organization.
TSN protein
1-228 amino acids: MSVSEIFVEL QGFLAAEQDI REEIRKVVQS LEQTAREILT LLQGVHQGAG FQDIPKRCLK AREHFGTVKT HLTSLKTKFP AEQYYRFHEH WRFVLQRLVF LAAFVVYLET ETLVTREAVT EILGIEPDRE KGFHLDVEDY LSGVLILASE LSRLSVNSVT AGDYSRPLHI STFINELDSG FRLLNLKNDS LRKRYDGLKY DVKKVEEVVY DLSIRGFNKE TAAACVEK
Purity:Min. 95%Kv2.1 antibody
The Kv2.1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the Kv2.1 channel, a voltage-gated potassium channel that plays a crucial role in regulating neuronal excitability and cardiac muscle function. This antibody can be used for various applications, including immunohistochemistry, immunoprecipitation, and western blotting.Fatty Acid Synthase antibody
The Fatty Acid Synthase antibody is a polyclonal antibody that specifically targets the biomolecule involved in fatty acid synthesis. This antibody has been shown to be activated by interferon and can effectively neutralize the target molecule, making it a valuable tool in life sciences research. It has been used in various applications such as electrode coating, collagen staining, and immunohistochemistry. Additionally, this antibody has shown binding affinity to galectin-3, another important biomolecule. With its high specificity and versatility, the Fatty Acid Synthase antibody is an essential component for any researcher studying lipid metabolism or investigating related diseases.Purity:Min. 95%c-Jun antibody
The c-Jun antibody is a highly specialized antibody that targets c-jun phosphorylation, a process involved in the regulation of gene expression. It interacts with the nuclear receptor peroxisome proliferator-activated receptor-alpha (PPAR-alpha) and inhibits its activity. The c-Jun antibody has been extensively studied in Life Sciences research and has been shown to inhibit the DNA binding activity of PPAR-alpha. Furthermore, it has been demonstrated that this antibody can effectively block the activation of c-Jun by okadaic acid, a potent phosphatase inhibitor. The c-Jun antibody is also capable of neutralizing arginase activity in nuclear extracts, making it an invaluable tool for studying the role of arginase in cellular processes. Additionally, this antibody can be used to detect activated forms of c-Jun in immunoblotting and immunoprecipitation assays. The use of caspase inhibitors or statins can enhance the detection of phosphorylated forms of c-Jun when using this antibody. Finally
Purity:Min. 95%SLC22A7 antibody
SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS
Canine IgG protein
Canine IgG protein is a high-quality monoclonal antibody that is widely used in Life Sciences research. It is purified immunoglobulins that target specific antigens and are commonly used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. Canine IgG protein has been shown to inhibit microvessel density by blocking the activity of growth factors involved in angiogenesis. Additionally, this monoclonal antibody can be used to detect autoantibodies and monitor immune responses in experimental studies. The Canine IgG protein is supplied in a buffered solution that ensures stability and long shelf life. Its high affinity for nuclear β-catenin allows for accurate detection and quantification of this important marker. This product is manufactured using advanced techniques to ensure purity and consistency, making it an ideal choice for researchers looking for reliable results in their experiments.Purity:Min. 95%UBE3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE3A antibody, catalog no. 70R-5237
Purity:Min. 95%Arntl2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Arntl2 antibody, catalog no. 70R-8344Purity:Min. 95%Annexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the Annexin A2 protein. This antibody is commonly used in Life Sciences research and diagnostics. Annexin A2 is an acidic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. It has been shown to interact with epidermal growth factor (EGF) and act as a co-receptor for EGF receptor signaling.
HAPLN4 antibody
HAPLN4 antibody was raised in rabbit using the C terminal of HAPLN4 as the immunogenPurity:Min. 95%Progesterone Receptor antibody
The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the progesterone receptor, a protein that plays a crucial role in reproductive processes and hormone regulation. By binding to the progesterone receptor, this antibody allows for the detection and analysis of progesterone receptor expression levels in various tissues and cell types.Purity:Min. 95%Midkine protein
Region of Midkine protein corresponding to amino acids VAKKKDKVKK GGPGSECAEW AWGPCTPSSK DCGVGFREGT CGAQTQRIRC RVPCNWKKEF GADCKYKFEN WGACDGGTGT KVRQGTLKKA RYNAQCQETI RVTKPCTPKT KAKAKAKKGK GKD.Purity:Min. 95%PRDX6 antibody
The PRDX6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein peroxiredoxin 6 (PRDX6), which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research involving cholinergic signaling, electrode development, and protein kinase studies.
KIAA0284 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0284 antibody, catalog no. 70R-3488
Purity:Min. 95%TMEM139 antibody
TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN
SYNCRIP antibody
The SYNCRIP antibody is a protein-based product that falls under the category of antibodies. It is specifically designed for use in life sciences research and has potential therapeutic applications. This polyclonal antibody is highly effective in targeting and binding to the SYNCRIP protein, enabling researchers to study its functions and interactions within cells. With its high specificity and sensitivity, this antibody is an invaluable tool for scientists working in various fields such as molecular biology, cell biology, and biochemistry. Whether you are investigating gene expression regulation or studying protein-protein interactions, the SYNCRIP antibody is a reliable choice that will help advance your research efforts.
CBX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CBX3 antibody, catalog no. 20R-1095Purity:Min. 95%ARID5A antibody
ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogenPurity:Min. 95%hCG_1646157 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_1646157 antibody, catalog no. 70R-9035
Purity:Min. 95%LRRC17 antibody
LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELPDCD6IP antibody
The PDCD6IP antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the PDCD6IP protein, also known as Programmed Cell Death 6 Interacting Protein. This protein plays a crucial role in various cellular processes, including cell death regulation and signal transduction.
SPSB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10123
Purity:Min. 95%OR6C75 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C75 antibody, catalog no. 70R-6259
Purity:Min. 95%MSH2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MSH2 antibody, catalog no. 70R-5689
Purity:Min. 95%ARSE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARSE antibody, catalog no. 70R-7488
Purity:Min. 95%TMPRSS3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS3 antibody, catalog no. 70R-3258
Purity:Min. 95%SPIC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPIC antibody, catalog no. 70R-8422Purity:Min. 95%EGFR antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes, which have shown high levels of human activity. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug exhibits a specific affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.Purity:Min. 95%ZNF714 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF714 antibody, catalog no. 70R-9014
Purity:Min. 95%Prolactin protein
Region of Prolactin protein corresponding to amino acids MLPICSAGDC QTSLRELFDR VVILSHYIHT LYTDMFIEFD KQYVQDREFM VKVINDCPTS SLATPEDKEQ ALKVPPEVLL NLILSLVQSS SDPLFQLITG VGGIQEAPEY ILSRAKEIEE QNKQLLEGVE KIISQAYPEA KGNGIYFVWS QLPSLQGVDE ESKILSLRNT IRCLRRDSHK VDNFLKVLRC QIAHQNNC.Purity:Min. 95%OR2M2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2M2 antibody, catalog no. 70R-9869
Purity:Min. 95%TMF1 antibody
TMF1 antibody was raised in rabbit using the N terminal of TMF1 as the immunogen
Purity:Min. 95%p130Cas antibody
The p130Cas antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets lipoprotein lipase and has been shown to have antiviral properties. The antibody can also inhibit glycosylation and fatty acid synthesis. In the field of Life Sciences, this antibody is widely used in research and diagnostic applications. It can be used in colloidal gold-based assays as well as in immunohistochemistry experiments. The p130Cas antibody has shown potential as a neuroprotective agent and has been studied for its ability to modulate interferon signaling pathways. Its versatility makes it an essential tool for researchers in various fields.ITAC protein
Region of ITAC protein corresponding to amino acids FPMFKRGRCL CIGPGVKAVK VADIEKASIM YPSNNCDKIE VIITLKENKG QRCLNPKSKQ ARLIIKKVER KNF.Purity:Min. 95%HSPG2 antibody
The HSPG2 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets mesothelin, a protein involved in cell growth and development. This antibody can be used to study the role of mesothelin in various biological processes, such as cell signaling, growth factor regulation, and fibrinogen and chemokine interactions.SFPQ antibody
SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
RCA antibody
The RCA antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to endonucleases, which are enzymes involved in DNA repair and replication processes. By binding to these enzymes, the RCA antibody exerts a cytotoxic effect on cells, inhibiting their growth and proliferation.AFM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AFM antibody, catalog no. 70R-8008
Purity:Min. 95%Serotonin receptor 2B antibody
Serotonin receptor 2B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKFactor XI antibody
Factor XI antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is specifically designed to target and bind to Factor XI, a growth factor involved in various physiological processes. This antibody can be used in research settings to study the role of Factor XI in insulin signaling pathways, glycosylation processes, and epidermal growth factor regulation.
Ku80 antibody
The Ku80 antibody is a highly specific monoclonal antibody that targets antiphospholipid antibodies. It has been extensively studied and shown to have neutralizing properties against these antibodies. The antibody binds to specific acid residues on the surface of the target, effectively blocking their activity. This makes it a valuable tool for researchers in the field of Life Sciences who are studying antiphospholipid antibodies and their role in various diseases.
JMJD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD5 antibody, catalog no. 70R-9587
Purity:Min. 95%OR2H1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2H1 antibody, catalog no. 70R-9861
Purity:Min. 95%Factor VIII antibody
Factor VIII antibody was raised in sheep using human Factor VIII purified from concentrate as the immunogen.
FMO5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FMO5 antibody, catalog no. 70R-6639
Purity:Min. 95%RPS6KB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS6KB1 antibody, catalog no. 70R-3693
Purity:Min. 95%RPS16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS16 antibody, catalog no. 20R-1082
Purity:Min. 95%TRUB2 antibody
TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
TLR4 antibody
TLR4 antibody was raised in rabbit using the C terminal of TLR4 as the immunogenPurity:Min. 95%MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
CD3 antibody
CD3 antibody was raised in Mouse using a purified recombinant fragment of human CD3 expressed in E. coli as the immunogen.TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
AF10 antibody
The AF10 antibody is a monoclonal antibody that exhibits serum albumin-binding properties. It is commonly used in the field of Life Sciences for various applications. This antibody specifically targets amyloid plaque and can be used for research related to Alzheimer's disease and other neurodegenerative disorders. In addition, the AF10 antibody has been shown to bind to nuclear proteins, antibodies, and growth factors, making it a versatile tool in various biological studies. Furthermore, this antibody has demonstrated efficacy in detecting glycosylation patterns in human serum and studying endothelial growth and necrosis factor-related apoptosis-inducing factors. With its wide range of applications, the AF10 antibody is an invaluable resource for researchers in the field of Life Sciences.SIGLEC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6185
Purity:Min. 95%
