Biochemicals and Reagents

<p>Rat monoclonal B7RP1 antibody (PE)</p>

<p>Cytokeratin 19 antibody is a low-molecular-weight monoclonal antibody that specifically binds to cytokeratin 19, a protein found in epithelial cells. This antibody has been used in various applications in the field of life sciences, including research and diagnostics. It can be used to detect and quantify cytokeratin 19 expression in tissues and cells, making it a valuable tool for studying epithelial cell biology. The dextran sulfate conjugated to the antibody enhances its stability and allows for efficient binding to target molecules. Whether you're conducting experiments or developing new diagnostic assays, this cytokeratin 19 antibody is an essential component for your research toolkit. Trust its high specificity and sensitivity to deliver accurate and reliable results.</p>

<p>Rabbit polyclonal TXLNA antibody</p>

<p>ELISA buffer for optimal coating and binding of antibodies and antigens</p>

<p>CD4 antibody (PE) was raised in mouse using human CD4 as the immunoge.</p>

<p>Rabbit polyclonal Kinase E9 antibody</p>

<p>Purified recombinant DOK4 protein (His tag)</p>

<p>GYG1 antibody was raised in Rabbit using Human GYG1 as the immunogen</p>

<p>LPIN2 antibody was raised in Rabbit using Human LPIN2 as the immunogen</p>

<p>The CD13 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets CD13, also known as Aminopeptidase N. This protein plays a crucial role in various physiological processes, including cell adhesion, migration, and signal transduction.</p>

<p>LMOD3 antibody was raised in Rabbit using Human LMOD3 as the immunogen</p>

<p>PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS</p>

<p>The TACC3 antibody is a protein that acts as a monoclonal antibody. It specifically targets TNF-related apoptosis-inducing ligand (TRAIL), which plays a crucial role in cell death regulation. The TACC3 antibody has been shown to inhibit the activity of TRAIL, preventing it from triggering apoptosis in cells. This makes it an effective tool for research and development in the field of life sciences.</p>

<p>The IVD antibody is a powerful tool in the field of Life Sciences. It is a glycopeptide that specifically targets alpha-fetoprotein, chemokines, and globulins. This monoclonal antibody is designed to recognize and bind to specific antigens, allowing for precise detection and analysis. With its glycosylation properties, the IVD antibody can effectively neutralize and inhibit factors that may be harmful to the body. Additionally, it has been shown to have neuroprotective effects and can enhance the activity of interferon-gamma (IFN-gamma). Its ability to interact with glycans makes it a versatile tool in various research applications. Trust the IVD antibody to provide accurate and reliable results for your experiments and studies.</p>

<p>The GPI antibody is a biomolecule that belongs to the class of antibodies. It has been shown to have neutralizing effects on influenza hemagglutinin and is widely used in the field of Life Sciences. This monoclonal antibody can be used in various applications, including as a diagnostic tool or therapeutic agent. It has been extensively studied and characterized for its ability to bind specifically to its target antigen. The GPI antibody has been used in research studies involving DNA vaccines, neonatal serum, and human serum samples. Additionally, it has been utilized in the detection and measurement of autoantibodies, such as antiphospholipid antibodies, making it an invaluable tool for researchers in this field. With its high specificity and affinity, this monoclonal antibody is an essential component in various scientific experiments and assays.</p>

<p>Rabbit polyclonal Prx III antibody</p>

<p>MINK1 antibody was raised in Rabbit using Human MINK1 as the immunogen</p>

<p>Rabbit polyclonal TASP1 antibody</p>

<p>Rabbit polyclonal RANBP6 antibody</p>

<p>ZBTB26 antibody was raised in rabbit using the C terminal of ZBTB26 as the immunogen</p>

<p>Inhibitor of ribosomal protein kinase p70S6K</p>

<p>Ece2 antibody was raised in rabbit using the middle region of Ece2 as the immunogen</p>

<p>Purified Polyclonal CNGB1 antibody</p>

<p>The iNOS antibody is a highly specialized polyclonal antibody that targets the inducible nitric oxide synthase (iNOS). It is commonly used in life sciences research to study the role of iNOS in various biological processes. This antibody specifically binds to iNOS and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal STK33 antibody</p>

<p>Hepatitis C virus antibody was raised in mouse using hepatitis C core antigen as the immunogen.</p>

<p>This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.</p>

<p>Mouse monoclonal SGCD antibody</p>

<p>MRPL45 antibody was raised in Rabbit using Human MRPL45 as the immunogen</p>

<p>SLCO5A1 antibody was raised in rabbit using the middle region of SLCO5A1 as the immunogen</p>

<p>Rabbit polyclonal SPIN2B antibody</p>

<p>GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH</p>

<p>KIAA1468 antibody was raised in Rabbit using Human KIAA1468 as the immunogen</p>

<p>Rabbit polyclonal STMN1 antibody (Ser62)</p>

<p>MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD</p>

<p>Purified Polyclonal MGST2 antibody</p>

<p>The PPM1G antibody is a highly potent inhibitor that belongs to the class of antibodies used in Life Sciences. It exhibits an inhibitory effect on phosphatase activity, making it an essential tool for research and industrial applications. This monoclonal antibody specifically targets PPM1G, a phosphatase enzyme involved in various cellular processes. The PPM1G antibody can be used for immobilization purposes or as part of molecular modeling studies. Its specificity and high affinity make it a valuable asset in the field of antibody-based research and development.</p>

<p>Spi2A Monoclonal Antibody</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>Rabbit polyclonal BAD antibody (Ser91/128)</p>

<p>Mouse monoclonal SHPK antibody</p>

<p>Rabbit polyclonal STAT6 antibody (Thr645)</p>

<p>Rabbit polyclonal MYST2 antibody</p>

<p>Rabbit polyclonal Chl78 antibody</p>

<p>Mouse monoclonal CD28 antibody (FITC); target rat</p>

<p>Folic acid-OVA conjugate</p>

<p>HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR</p>

<p>MSH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR</p>

<p>Rabbit polyclonal NFkB antibody (Regulatory Factor)</p>

<p>The Caspase 3 antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used to study apoptosis, the process of programmed cell death. This antibody specifically targets caspase 3, an enzyme involved in the execution phase of apoptosis. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>SKF 83822 is a medicinal compound that acts as a cyclin-dependent kinase inhibitor. It has been shown to have potential as an anticancer agent, particularly for the treatment of leukemia and other tumors. This compound inhibits the activity of cyclin-dependent kinases, which play a crucial role in cell cycle regulation and proliferation. By blocking this process, SKF 83822 induces apoptosis (programmed cell death) in cancer cells, leading to their destruction. In addition to its effects on cancer cells, this compound has also been found to have anti-inflammatory properties in Chinese hamster ovary cells. Overall, SKF 83822 shows promise as a potent inhibitor of protein kinases and may be useful in the development of new cancer therapies.</p>

<p>Ricinus communis Antibody</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Please enquire for more information about Minoxidil sulfate-d10 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant LAGE3 protein (His tag)</p>

<p>HIF1AN antibody was raised in Rabbit using Human HIF1AN as the immunogen</p>

<p>Rabbit polyclonal Caspase 9 antibody (Tyr153)</p>

<p>Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA</p>

<p>ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The IRS1 antibody is a highly specialized antibody that targets the insulin receptor substrate 1 (IRS1). This antibody is widely used in research and diagnostic applications to study various cellular processes and signaling pathways.</p>

<p>MUM1 antibody was raised in Mouse using a purified recombinant fragment of human MUM1 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal ICE antibody</p>

<p>BXDC1 antibody was raised in mouse using recombinant Human Brix Domain Containing 1 (Bxdc1)</p>

<p>HOOK2 antibody was raised in Rabbit using Human HOOK2 as the immunogen</p>

<p>Rabbit polyclonal CD227 antibody (Tyr1243)</p>

<p>Purified Polyclonal NDUFS1 antibody</p>

<p>Rabbit polyclonal SCNN1G antibody</p>

<p>Mouse monoclonal gamma delta TCR antibody (PE)</p>

<p>ANGPTL2 antibody was raised using the N terminal of ANGPTL2 corresponding to a region with amino acids NSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVK</p>

<p>PRG3 antibody was raised in rabbit using residues 170-185 [VTLIHSQVALADKELL] of the 41 kDa human PRG3 protein as the immunogen.</p>

<p>The PPP1R15A antibody is a powerful tool used in various research applications. This antibody specifically targets the PPP1R15A protein, which plays a crucial role in cellular responses to stress and the regulation of protein synthesis.</p>

<p>M6PRBP1 antibody was raised in Rabbit using Human M6PRBP1 as the immunogen</p>

<p>Mouse monoclonal alpha Adaptin antibody</p>

<p>The VGLL1 antibody is a highly specific monoclonal antibody that targets mesothelin, a serum albumin protein. It is widely used in the field of Life Sciences for various research applications. This antibody has been shown to effectively detect and quantify mesothelin levels in biological samples, making it an invaluable tool for studying its expression and function. Additionally, the VGLL1 antibody has been proven to modulate glutamate signaling and regulate e-cadherin expression, which are essential processes in cellular communication and adhesion. Furthermore, this antibody has demonstrated interactions with other important proteins such as osteopontin, oncostatin, and β-catenin, suggesting its involvement in multiple signaling pathways. The VGLL1 antibody is available as both monoclonal and polyclonal antibodies and is compatible with human serum samples. With its high specificity and ability to activate downstream signaling pathways, the VGLL1 antibody is an indispensable resource for researchers in various fields of study.</p>

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>Purified Rabbit polyclonal RPC5 antibody</p>

<p>Rabbit polyclonal TGF beta 3 antibody</p>

<p>Rab11B antibody was raised in Rat using Mouse RAB11B and GST fusion protein as the immunogen.</p>

<p>CLIC3 antibody was raised in rabbit using the N terminal of CLIC3 as the immunogen</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2a kappa; clone RM4-5</p>

<p>Rabbit polyclonal SRPR antibody</p>

<p>The IL16 antibody is a powerful tool in the field of Life Sciences. It is an interferon that plays a crucial role in various biological processes. This polyclonal antibody targets IL16, which is involved in the regulation of immune responses and inflammation. The IL16 antibody can be used for applications such as immunoassays, immunohistochemistry, and Western blotting.</p>

<p>OVA conjugated Ractopamine Hapten</p>

<p>FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN</p>

<p>Rabbit polyclonal FMN2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using techniques like patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Mouse monoclonal XRCC1 antibody</p>

<p>Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen</p>

<p>Normal Donkey Serum is a valuable biospecimen used in various life science and veterinary applications. Derived from donkeys, this serum contains a range of important components that make it useful for research purposes. Normal Donkey Serum is commonly used as a blocking agent to prevent non-specific binding of antibodies in immunohistochemistry and immunocytochemistry experiments. It also serves as an essential component in the development of monoclonal antibodies and other cell-based assays. This serum contains various growth factors, such as epidermal growth factor, which can promote cell proliferation and differentiation. Additionally, Normal Donkey Serum contains inhibitors that can modulate specific signaling pathways, including the interferon pathway and the phosphoinositide 3-kinase (PI3K) pathway. Researchers often use Normal Donkey Serum as a control or reference sample in their experiments. Its acidic pH and low hemolysis rate make it suitable for a wide range of applications. Furthermore, its immobilization properties allow for stable electrode</p>

<p>NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE</p>

<p>RPS16 antibody was raised in rabbit using the N terminal of RPS16 as the immunogen</p>

<p>The His tag antibody is a hormone peptide used in Life Sciences. It acts as an anti-connexin agent and can bind to collagen. This antibody is commonly used in research and diagnostics. It is available in both polyclonal and monoclonal forms, allowing for a wide range of applications. The His tag antibody has glycan-binding properties, making it suitable for studying glycan structures. Additionally, it has neutralizing capabilities against certain targets and can be used as a neuroprotective agent. With its high specificity and affinity, the His tag antibody is a valuable tool in the field of molecular biology.</p>

<p>The Vibrio cholerae O1 Ogawa &amp; Inaba antibody is a powerful tool used in the field of Life Sciences. This monoclonal antibody specifically targets the galactose and tyrosine residues present on the cell surface antigen of Vibrio cholerae O1 strains, including both Ogawa and Inaba serotypes. It plays a crucial role in various research applications, such as immunohistochemistry, flow cytometry, and ELISA.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2D2 antibody, catalog no. 70R-6976</p>

<p>RanBP17 antibody was raised in rabbit using RanBP17 protein. as the immunogen.</p>

<p>CORT antibody was raised in rabbit using the N terminal of CORT as the immunogen</p>

<p>The JAK2 antibody is a highly specialized product used in the field of Life Sciences. It is an immobilized polyclonal antibody that specifically targets tyrosine residues on JAK2 proteins. This antibody is designed to be used in various research applications, including the detection and quantification of activated JAK2 in human serum samples.</p>