Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
CEA Antibody
The CEA Antibody is a growth factor that belongs to the family of antibodies. It specifically targets anti-ACTH antibodies and acts as a monoclonal antibody. This antibody has been shown to inhibit the activity of kinase inhibitors, which are involved in various biological processes. Additionally, it interacts with adipose tissue and fibrinogen, playing a crucial role in Life Sciences research. The CEA Antibody also modulates dopamine levels and exhibits binding affinity towards low-density lipoprotein receptors and annexin proteins. Furthermore, it interacts with adiponectin receptors, contributing to the regulation of adiponectin levels in the body. With its multifaceted properties, the CEA Antibody offers great potential for scientific studies and therapeutic applications.
C18orf25 antibody
C18orf25 antibody was raised using the N terminal of C18orf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADSTCXCL3/GRO gamma protein (His tag)
35-107 amino acids: MGSSHHHHHH SSGLVPRGSH MASVVTELRC QCLQTLQGIH LKNIQSVNVR SPGPHCAQTE VIATLKNGKK ACLNPASPMV QKIIEKILNK GSTNPurity:Min. 95%A1BG antibody
A1BG antibody was raised using the N terminal of A1BG corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGMERTK Antibody
The MERTK Antibody is a monoclonal antibody that is used in Life Sciences research. It targets the MERTK protein, which is a receptor tyrosine kinase involved in cell growth and development. This antibody can be used to study the role of MERTK in various biological processes, including cell signaling, immune response, and cancer progression. The MERTK Antibody has been shown to bind specifically to the MERTK protein and inhibit its activity. It can also be used for immunohistochemistry, western blotting, and flow cytometry experiments. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying MERTK and its associated pathways.PIAS2 antibody
The PIAS2 antibody is a test substance that is highly effective in the field of Life Sciences. It is an interferon-inducible protein that plays a crucial role in regulating polypeptide expression. This antibody has been extensively used in research and has shown promising results in various areas, including the development of medicines and treatments.NOTCH1 antibody
The NOTCH1 antibody is a powerful tool in the field of life sciences. It specifically targets the lipoprotein lipase and acts as a tyrosine kinase receptor inhibitor. This monoclonal antibody plays a crucial role in regulating growth factors and hormone receptors, making it an essential component in various research studies.APBB3 antibody
APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRFibrillarin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBL antibody, catalog no. 70R-1360
Purity:Min. 95%WIF1 antibody
WIF1 antibody was raised in rabbit using the N terminal of WIF1 as the immunogenPurity:Min. 95%RALB antibody
The RALB antibody is a high-quality monoclonal antibody used in Life Sciences. It is specifically designed to target and neutralize RALB, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy in antigen-antibody reactions.PPP1R8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-4733Purity:Min. 95%CHK2 antibody
CHK2 antibody was raised in Mouse using a purified recombinant fragment of human CHK2 (aa481-531) expressed in E. coli as the immunogen.Donkey anti Goat IgG (H + L) (FITC)
Donkey anti-goat IgG (H + L) (FITC) was raised in donkey using goat IgG (H & L) as the immunogen.SR140 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SR140 antibody, catalog no. 70R-4844Purity:Min. 95%PRDX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRDX1 antibody, catalog no. 70R-2253Purity:Min. 95%Caspase 1 antibody
The Caspase 1 antibody is a highly effective globulin that acts as a neutralizing agent against caspase 1. This monoclonal antibody has been specifically developed to target and inhibit the activity of caspase 1, an enzyme involved in inflammatory responses. By binding to caspase 1, this antibody blocks its function and prevents the release of pro-inflammatory cytokines.FAS ligand antibody
The FAS ligand antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the FAS ligand, a protein involved in various cellular processes such as collagen production, dopamine regulation, erythropoietin synthesis, and fibrinogen formation. By binding to the FAS ligand, this antibody effectively inhibits its function and disrupts downstream signaling pathways.CYP11B1 antibody
CYP11B1 antibody was raised in rabbit using the middle region of CYP11B1 as the immunogenPurity:Min. 95%p16 antibody
p16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogenPurity:Min. 95%LPP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LPP antibody, catalog no. 70R-2082Purity:Min. 95%ZNF33A antibody
ZNF33A antibody was raised using the middle region of ZNF33A corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWDIgG1 Isotype Control Fc fusion protein (PE)
Rat monoclonal IgG1 Isotype Control Fc fusion protein (PE)
Purity:Min. 95%MuSK antibody
MuSK antibody was raised in Mouse using purified recombinant extracellular fragment of human MuSK (aa24-209) fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.AK2 protein (His tag)
1-239 amino acids: MGSSHHHHHH SSGLVPRGSH MAPSVPAAEP EYPKGIRAVL LGPPGAGKGT QAPRLAENFC VCHLATGDML RAMVASGSEL GKKLKATMDA GKLVSDEMVV ELIEKNLETP LCKNGFLLDG FPRTVRQAEM LDDLMEKRKE KLDSVIEFSI PDSLLIRRIT GRLIHPKSGR SYHEEFNPPK EPMKDDITGE PLIRRSDDNE KALKIRLQAY HTQTTPLIEY YRKRGIHSAI DASQTPDVVF ASILAAFSKA TCKDLVMFIPurity:Min. 95%THEG antibody
THEG antibody was raised in rabbit using the middle region of THEG as the immunogenPurity:Min. 95%TAFA2 protein
Region of TAFA2 protein corresponding to amino acids MANHHKAHHV KTGTCEVVAL HRCCNKNKIE ERSQTVKCSC FPGQVAGTTR AAPSCVDASI VEQKWWCHMQ PCLEGEECKV LPDRKGWSCS SGNKVKTTRV TH.Purity:Min. 95%GCSF antibody
GCSF antibody was raised in rabbit using highly pure recombinant human G-CSF as the immunogen.Purity:Min. 95%NBN antibody
The NBN antibody is a highly effective immunomodulatory agent that has the ability to modulate the immune response by targeting interleukins and pyroptotic cells. It specifically interacts with inflammasome proteins, which are crucial for the activation of inflammatory responses. This antibody exhibits opsonophagocytic activity, enhancing the ability of immune cells to engulf and eliminate pathogens. Through advanced cytometry analysis, it has been shown to promote the production of antibody-secreting cells, leading to a stronger immune response. The NBN antibody can be used in various life science applications, including fluorescent assays and protein complex studies. With its potent capabilities and specificity, this monoclonal antibody is a valuable tool for researchers in the field of immunology.Glycoprotein Ib Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GP1BA antibody, catalog no. 70R-6193Purity:Min. 95%Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H + L) (biotin) was raised in donkey using goat IgG (H & L) as the immunogen.Ku80 antibody
The Ku80 antibody is a serotonergic antibody that targets the c-myc protein. It is widely used in the Life Sciences field for various applications. This polyclonal antibody is derived from human serum and specifically recognizes the fatty acid-activated nuclear alpha-fetoprotein hormone peptide. The Ku80 antibody can be used in experiments involving immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and affinity make it an ideal tool for detecting and quantifying the target antigen. Whether you're conducting research or developing diagnostic tests, the Ku80 antibody is a valuable asset in your laboratory.LRP antibody (515 kDa)
LRP antibody (515 kDa) was raised in mouse using human LRP/a2MR as the immunogen.SLC44A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC44A3 antibody, catalog no. 70R-6722Purity:Min. 95%PLOD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLOD2 antibody, catalog no. 70R-5438Purity:Min. 95%TUBA8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUBA8 antibody, catalog no. 70R-9492Purity:Min. 95%OTOR protein
Region of OTOR protein corresponding to amino acids MVHGIFMDRL ASKKLCADDE CVYTISLASA QEDYNAPDCR FINVKKGQQI YVYSKLVKEN GAGEFWAGS VYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE.
Purity:Min. 95%Mrps33 antibody
Mrps33 antibody was raised in rabbit using the middle region of Mrps33 as the immunogenPurity:Min. 95%Opioid Receptor antibody
The Opioid Receptor antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets the opioid receptor protein, which plays a crucial role in pain modulation and addiction pathways.Purity:Min. 95%MEGF11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MEGF11 antibody, catalog no. 70R-8850
Purity:Min. 95%SIGLEC12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6148Purity:Min. 95%EME1 antibody
EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISCARD17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CARD17 antibody, catalog no. 70R-10271
Purity:Min. 95%Peanut Protein Antibody
The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.SMN1 antibody
SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVMIA antibody
MIA antibody was raised in rabbit using highly pure recombinant human MIA as the immunogen.Purity:Min. 95%DKFZp686E2433 antibody
DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogenPurity:Min. 95%SERPINA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA3 antibody, catalog no. 70R-5915Purity:Min. 95%MAF antibody
The MAF antibody is a polyclonal antibody used in Life Sciences. It is designed to target specific proteins and molecules, such as helicobacter, botulinum toxin, β-catenin, epidermal growth factor, and more. This antibody has been extensively tested and proven to be effective in various applications, including Western blotting, immunohistochemistry, and ELISA.XPO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XPO1 antibody, catalog no. 70R-4738Purity:Min. 95%NARG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1 antibody, catalog no. 70R-4599Purity:Min. 95%VARS antibody
VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKMLCHK1 antibody
The CHK1 antibody is a specific antibody that targets the checkpoint kinase 1 (CHK1) protein. It has been extensively used in life sciences research to study various cellular processes and signaling pathways. The CHK1 protein plays a crucial role in cell cycle regulation, DNA damage response, and cell survival. By inhibiting CHK1, this antibody can help researchers gain insights into the mechanisms of cancer development and identify potential therapeutic targets.
ZFP90 antibody
ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogenPurity:Min. 95%IGF1 protein
1-115 amino acids: MGPETLCGAE LVDALQFVCG DRGFYFNKPT GYGSSSRRAP QTGIVDECCF RSCDLRRLEM YCAPLKPAKS APurity:Min. 95%Goat anti Human κ chain (FITC)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%YB1 antibody
The YB1 antibody is a highly specialized monoclonal antibody that targets the cannabinoid receptor. It has been extensively studied for its potential therapeutic applications in various fields, including antiviral treatments and cancer research. The YB1 antibody has shown promising results in neutralizing the effects of certain viruses by inhibiting their replication and entry into host cells. Additionally, it has been found to have potent antitumor properties, particularly in breast cancer (MCF-7) and mesenchymal stem cells. This antibody also plays a crucial role in regulating cellular processes such as protein synthesis and phosphatase activity. Its unique binding affinity to specific receptors, such as P2X receptors, makes it an invaluable tool for studying their functions and developing targeted therapies. With its diverse range of applications and exceptional specificity, the YB1 antibody is a valuable asset for researchers in various scientific disciplines.
SUMO1 antibody
The SUMO1 antibody is a glycoprotein that belongs to the class of lectins. It is a monoclonal antibody that specifically targets SUMO1, a small ubiquitin-like modifier protein. This antibody has been extensively used in research and diagnostics in the field of Life Sciences. The SUMO1 antibody has high specificity and affinity for its target, making it an ideal tool for studying the function and regulation of SUMOylation. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Additionally, this antibody has been shown to inhibit protease activity associated with SUMOylation, making it a valuable tool for investigating the role of SUMOylation in cellular processes. With its unique properties and wide range of applications, the SUMO1 antibody is an essential tool for researchers in the field of protein kinase inhibitors and autoantibodies.
ST3GAL5 antibody
ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
HSPA6 antibody
HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV
