Biochemicals and Reagents

<p>NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT</p>

<p>Rabbit polyclonal ErbB2 antibody (Thr686)</p>

<p>JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ</p>

<p>Mouse monoclonal ATG3 antibody</p>

<p>MAP3K10 antibody was raised in Rabbit using Human MAP3K10 as the immunogen</p>

<p>Lerociclib dihydrochloride is a selective cyclin-dependent kinase 4 and 6 (CDK4/6) inhibitor, which is derived from targeted chemical synthesis. Its mode of action involves binding to CDK4/6 and inhibiting their activity, which in turn blocks the phosphorylation of the retinoblastoma (Rb) protein. This results in the prevention of cell cycle progression from the G1 to the S phase, thereby exerting antiproliferative effects on tumor cells that rely on the CDK4/6 pathway.</p>

<p>ARR3 antibody was raised in rabbit using the C terminal of ARR3 as the immunogen</p>

<p>The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.</p>

<p>CJ-13610 is an active inhibitor of the sorbitol dehydrogenase enzyme. CJ-13610 has been shown to inhibit the production of inflammatory cytokines in vitro and in vivo, which may be due to its ability to inhibit the activity of human polymorphonuclear leukocytes. This drug also has an effect on bowel disease, fatty acid metabolism, and polymorphic enzymes in rat liver microsomes.</p>

<p>Rabbit anti-canine IgG (H + L) (biotin) was raised in rabbit using canine IgG (H&amp;L) as the immunogen.</p>

<p>SNIPER(ABL)-039 is a heterobifunctional chemical compound, which is a synthetic molecule manufactured through advanced organic synthesis techniques. This compound functions by specifically targeting and binding to aberrant BCR-ABL fusion proteins, utilizing a protein degradation pathway. It operates through the proteolysis-targeting chimera (PROTAC) mechanism, whereby it recruits E3 ubiquitin ligase to the target protein, leading to its ubiquitination and subsequent proteasomal degradation.</p>

<p>TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV</p>

<p>3α-OH clostebol is a synthetic anabolic steroid that is used to increase muscle mass and appetite in horses. It is not approved for use in humans, but has been detected in athletes who have tested positive for steroids. 3α-OH clostebol binds to the glucuronic acid receptor on the cell membrane and activates it, which causes an increase in the production of certain proteins. This process may be due to its ability to inhibit a metabolic pathway that leads to the production of proteins within cells. The drug has been shown to be effective at increasing muscle mass when administered intramuscularly, as well as decreasing fat mass when administered orally. 3α-OH clostebol also has a number of side effects including increased blood pressure and heart rate, which can lead to cardiovascular disorders such as heart attacks or strokes.</p>

<p>Purified recombinant TINAGL1 protein (His tag)</p>

<p>Mouse monoclonal PPME1 antibody</p>

<p>The CYP1A2 antibody is an activated monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize the CYP1A2 enzyme, which plays a crucial role in drug metabolism. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Rabbit polyclonal GRM2 antibody</p>

<p>m-dPEG®8-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Emi1 is a coumarin derivative that is used as a fluorescent dye to monitor the efficiency of electroluminescent devices. Emi1 emits orange light in the visible spectrum when excited by light. Emi1 has been shown to be an efficient emitter of light, with a quantum efficiency of about 50%.</p>

<p>Rabbit polyclonal SCEL antibody</p>

<p>Mouse monoclonal UBA2 antibody</p>

<p>1. Activates TRPV1 receptor, which is involved in the transmission of pain signals and the release of inflammatory mediators<br>2. Binds to and activates P2X7 receptors, which are associated with cell death and inflammation<br>3. Blocks voltage-gated calcium channels, which play a role in neuronal excitability and muscle contraction<br>4. Inhibits the activity of MAP kinase phosphatases, which are involved in regulating the activation of MAP kinase <br>5. Stimulates ligand-gated ion channels such as nicotinic acetylcholine receptors (nAChRs) <br>6. Binds to GABA receptors, inhibiting the effects of GABA on neurons <br>7. Acts as an antagonist at dopamine D2 receptors <br>8. Binds to muscarinic M1/M3 receptors, inhibiting acetylcholine release <br>9. Binds to alpha-adrenergic receptors, leading to vas</p>

<p>Purified recombinant JTB protein (His tag)</p>

<p>CYP2D6 antibody was raised using the middle region of CYP2D6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV</p>

<p>Synaptophysin antibody was raised in mouse using Synaptophysin from presynaptic vesicles prepared from bovine brain as the immunogen.</p>

<p>SMARCB1 antibody was raised in rabbit using the middle region of SMARCB1 as the immunogen</p>

<p>A2BP1 antibody was raised using the middle region of A2BP1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP</p>

<p>Anti Cephapirin C monoclonal</p>

<p>Amino-dPEG® t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG® t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>The IL1RL1 antibody is a medicament that belongs to the class of polyclonal and monoclonal antibodies. It is cytotoxic and specifically targets the TNF-related apoptosis-inducing ligand (TRAIL) receptor 1 (IL1RL1). This antibody can be used for therapeutic purposes in various diseases where TRAIL signaling is involved, such as cancer. The IL1RL1 antibody binds to IL1RL1 on the surface of cells and induces cell death by activating apoptotic pathways. It has been shown to inhibit the growth and proliferation of cells expressing IL1RL1, making it a potential treatment option for certain types of cancer. Additionally, this antibody has been used in research studies to investigate the role of IL1RL1 in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMA antibody, catalog no. 70R-5926</p>

<p>Less active isomer of latanoprost</p>

<p>Naxillin is a research tool that is an activator and ligand for the receptor. It binds to the receptor, which activates ion channels in cells. Naxillin has been shown to bind to many different types of cell receptors, including those on muscle cells, neurons, and immune cells. Naxillin is also a high-purity protein that has been extensively studied for its interactions with other proteins. Naxillin is a peptide with CAS Number 301176-96-5.</p>

<p>Bis-dPEG®5, Half Benzyl Half NHS Ester is a heterobifunctional cross-linking reagent, which is derived from discrete poly(ethylene glycol) chemistry. It features a benzyl group on one end and an N-hydroxysuccinimide (NHS) ester on the other. The NHS ester is a well-known active ester that facilitates the formation of stable amide bonds with primary amines, commonly found on proteins and peptides. By doing so, it enables the covalent attachment of biomolecules, enhancing solubility, stability, and overall bioavailability.</p>

<p>Goat anti-mouse IgG (H+L) (Fab'2) was raised in goat using murine IgG whole molecule as the immunogen.</p>

<p>ASK1-IN-2 is a peptide that activates the ASK1 (APPL1) kinase. It is used as a research tool to study protein interactions and receptor activation. ASK1-IN-2 has an affinity for phospholipid membranes and is soluble in water, making it suitable for use in pharmacological studies. This peptide is purified to a high purity with a CAS Number of 2541792-70-3.</p>

<p>The p90RSK antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to inhibit the activity of p90RSK, a family of serine/threonine kinases. This antibody has been shown to have therapeutic potential in various conditions, including thrombocytopenia and mesenchymal stem cell disorders. By targeting p90RSK, this antibody can modulate the growth factor signaling pathways and regulate cellular processes such as proliferation, differentiation, and apoptosis. Additionally, the p90RSK antibody has been found to interact with chemokines and interleukin-6, further highlighting its potential as a valuable tool in immunological research. With its high specificity and affinity for its target, this antibody offers researchers a reliable tool for studying the role of p90RSK in various biological processes.</p>

<p>GOLGA1 antibody was raised in Rabbit using Human GOLGA1 as the immunogen</p>

<p>Probenecid-d14 is a peptide that acts as an activator of ion channels. It can be used as a research tool for studying the mechanism of action of ion channels and their involvement in cell biology, such as protein interactions, receptor activation, ligand binding, and pharmacology. Probenecid-d14 has a purity of &gt;98% with a CAS number 1189657-87-1.</p>

<p>Rabbit polyclonal MRPS12 antibody</p>

<p>DS21360717 is a synthetic compound, classified as a small-molecule inhibitor, which originates from advanced chemical synthesis techniques within pharmaceutical research. Its mode of action involves targeting and modulating specific cellular pathways, often through inhibiting key enzymes or receptors involved in disease processes. This targeted interaction allows for precise modulation of biological reactions, making it a valuable tool in both research and therapeutic settings.</p>

<p>t-boc-N-Amido-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>BACE1 antibody was raised in Rabbit using Human BACE1 as the immunogen</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>MA242 is a targeted therapeutic agent, which is derived from advanced biochemical research. It operates through precise interaction with specific cellular targets, altering biochemical pathways that are essential for disease progression. This mode of action distinguishes MA242 as an innovative option within its class of therapeutics, allowing for enhanced efficacy while minimizing off-target effects.</p>

<p>ASB-16 is a small molecule that binds to β-catenin, which is a protein found in the cell nucleus. The binding of ASB-16 to β-catenin prevents the activation of transcription factors and subsequently suppresses tumor growth. ASB-16 has been shown to inhibit the proliferation of brain tumor cells and has potential for use as an anti-cancer agent. It also inhibits the growth of unfixed cultured cells, such as carnitine, by preventing their differentiation into myotubes. ASB-16 can be used to encapsulate drugs, proteins, or DNA during drug delivery. This compound has also been shown to bind with c2c12 myotubes with high binding constants and pyridinium ions with low binding constants. The interactions between ASB-16 and membranes are determined by detergent composition and calcium chelator concentration.</p>

<p>KEAP1 antibody was raised in Rabbit using Human KEAP1 as the immunogen</p>

<p>C7orf10 antibody was raised in Rabbit using Human C7orf10 as the immunogen</p>

<p>UNC84A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA</p>

<p>Lipoamido-dPEG®4-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®4-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>

<p>YM 244769 is a benzyloxyphenyl derivative of 2-aminoethoxydiphenyl borate. It has been shown to inhibit the uptake of glutamate into ventricular myocytes, and this effect was not observed in wild-type mice. This drug has also been shown to inhibit the uptake of glutamate into mitochondria, which is responsible for cellular energy production. YM 244769 has potential as a drug target for cardiac and bladder diseases.</p>

<p>CVT-12012 is an endogenous, unsaturated fatty acid that interacts with lymphoblastic leukemia cells. It has been found to inhibit the growth of leukemia cells in vitro and reduce tumor size in mice. CVT-12012 is thought to work by inhibiting fatty acid synthesis and increasing the levels of endogenous unsaturated fatty acids.</p>

<p>Balamapimod is a linker that can be used in the diagnosis and treatment of cancer. It is a prodrug that undergoes hydrolysis to produce an active drug, which binds to the amino acid sequence of tumor cells and disrupts the function of these cells. The drug is also able to crosslink with other molecules, such as proteins and nucleic acids, which are involved in the development of cancer. Balamapimod has been shown to inhibit the growth of tumor cells by blocking the synthesis of DNA and RNA. This drug has been shown to have no toxicity on healthy cells or tissues.</p>

<p>The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development</p>

<p>Azido-dPEG®24-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®24-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>MAL-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Eotaxin antibody was raised in mouse using highly pure recombinant human eotaxin as the immunogen.</p>

<p>The SENP1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the protein SUMO-specific protease 1 (SENP1), which plays a crucial role in the regulation of various cellular processes. This antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>The VCAM1 antibody is a monoclonal antibody that specifically targets the VCAM1 protein. This protein plays a crucial role in various biological processes, including cell adhesion and migration. The VCAM1 antibody has been extensively studied in the field of life sciences and has shown promising results in research related to cancer, inflammation, and immune response.</p>

<p>1-527 amino acids: MGSSHHHHHH SSGLVPRGSH MGKRQHQKDK MYITCAEYTH FYGGKKPDLP QTNFRRLPFD HCSLSLQPFV YPVCTPDGIV FDLLNIVPWL KKYGTNPSNG EKLDGRSLIK LNFSKNSEGK YHCPVLFTVF TNNTHIVAVR TTGNVYAYEA VEQLNIKAKN FRDLLTDEPF SRQDIITLQD PTNLDKFNVS NFYHVKNNMK IIDPDEEKAK QDPSYYLKNT NAETRETLQE LYKEFKGDEI LAATMKAPEK KKVDKLNAAH YSTGKVSASF TSTAMVPETT HEAAAIDEDV LRYQFVKKKG YVRLHTNKGD LNLELHCDLT PKTCENFIRL CKKHYYDGTI FHRSIRNFVI QGGDPTGTGT GGESYWGKPF KDEFRPNLSH TGRGILSMAN SGPNSNRSQF FITFRSCAYL DKKHTIFGRV VGGFDVLTAM ENVESDPKTD RPKEEIRIDA TTVFVDPYEE ADAQIAQERK TQLKVAPETK VKSSQPQAGS QGPQTFRQGV GKYINPAATE QQRKSPQPVP LSPCPRRSPV GVLGTSAPGS SRLPDDH</p>

<p>Rabbit polyclonal RAB10 antibody</p>

<p>Bis-dPEG®5-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®5-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>The Daxx antibody is a highly specialized medicament used in Life Sciences. It is an antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been shown to inhibit the glycosylation process of EGF, preventing its activation and subsequent signaling pathways. Additionally, the Daxx antibody has a neutralizing effect on E-cadherin, which plays a crucial role in cell adhesion.</p>

<p>The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.</p>

<p>Azido-dPEG®7-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®7-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>HOE 32021 is a fungicide, which is developed from synthetic chemical sources with a broad spectrum mode of action. As a multisite inhibitor, it targets several pathways crucial for fungal survival, effectively impeding spore germination and mycelial growth. This mode of action reduces the likelihood of resistance development among targeted pathogens.</p>

<p>PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC</p>

<p>DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR</p>

<p>DBPR112 is an analog that belongs to the group of kinase inhibitors. It has been shown to inhibit various kinases, which are enzymes involved in cellular signaling pathways that regulate cell growth and division. DBPR112 has demonstrated anticancer activity in vitro against a range of cancer cells, including Chinese hamster ovary cells, human breast cancer cells, and tumor xenografts. It also induces apoptosis, or programmed cell death, in cancer cells. DBPR112 is excreted in urine and may be used as a potential biomarker for monitoring anticancer therapy. This drug is not related to oseltamivir or any other antiviral medication but rather acts on protein targets within the cancer cell.</p>

<p>ZNF300 antibody was raised in rabbit using the N terminal of ZNF300 as the immunogen</p>

<p>The Myoglobin antibody is an activated monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to myoglobin, a protein found in human serum. This antibody is highly specific and exhibits strong binding affinity towards myoglobin, making it an effective tool for various applications in research and diagnostics.</p>

<p>GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA</p>

<p>Chiauranib is a potent and selective inhibitor of the ion channel TRPM2. It blocks the influx of calcium ions into cells, which leads to cell death. Chiauranib is also an inhibitor of the receptor-ligand interactions of corticotropin-releasing hormone (CRH) and vasopressin with CRH receptors, leading to the inhibition of their biological effects. This compound has been shown to be a high-quality research tool for pharmacology and protein interactions involving peptides. Chiauranib has not been shown to have any antibody reactivity or cytotoxicity in cell culture.</p>

<p>The ORC2 antibody is a powerful tool used in Life Sciences research. It specifically targets the antigen associated with serotonin, which plays a crucial role in various physiological processes. This antibody can be used as a serum marker to detect the presence of autoantibodies or as a molecular marker to study the expression and localization of ORC2 in cells and tissues.</p>

<p>Non-peptide GnRHR hormone receptor antagonist</p>

<p>4-Formyl-Benzamido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>m-dPEG®12-Lipoamide is a PEG molecule conjugated with a lipid moiety. m-dPEG®12-Lipoamide, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>

<p>dPEG®12 Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®12 Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>CBFB antibody was raised in Rabbit using Human CBFB as the immunogen</p>

<p>m-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Rabbit polyclonal PUB16 antibody</p>

<p>Factor B antibody was raised in Mouse using purified factor B from human blood as the immunogen.</p>

<p>GRO antibody was raised in rabbit using highly pure recombinant rat GRO/KC as the immunogen.</p>

<p>Tramadol Conjugate for use in immunoassays</p>

<p>Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Purified Rabbit polyclonal ATP1 alpha antibody (Ser23)</p>

<p>Diamido-dPEG®11-Diamine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Diamido-dPEG®11-Diamine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Rabbit polyclonal RLIM antibody</p>

<p>Mifamurtide sodium is a peptide that has been shown to activate the receptor for nerve growth factor (NGF) and is used as an anti-inflammatory drug. Mifamurtide sodium binds to NGF, which triggers the activation of the receptor that can lead to cell proliferation. This drug has also been shown to inhibit ion channels and ligand-gated ion channels, which are important in regulating cellular activity. Mifamurtide sodium is a research tool used in cell biology and neuroscience. It is also an antibody used in immunology and cancer research.</p>

<p>FLJ31875 antibody was raised in rabbit using the middle region of FLJ31875 as the immunogen</p>

<p>Purified Polyclonal PPP2R1B antibody</p>

<p>Rabbit polyclonal FAK antibody (Ser910)</p>

<p>(E)-N-[Trans-3-{1-(2-nitrophenyl)-1H-pyrrol-2-yl} allylidenamino]guanidinium acetate is a research tool that has been shown to be an activator of a variety of receptors. It binds to the receptor, which is an ion channel protein, and alters its properties. This compound has been shown to bind to ligands and receptors by competitive inhibition. In addition, it has been shown to inhibit the binding of antibodies to cell surface antigens. This compound may have potential use in pharmacology as a therapeutic drug for neurological disorders such as Alzheimer's disease.</p>

<p>MAL-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MAL-dPEG®2-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it undergoes metabolization. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth. Choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a powerful solution against tuberculosis.</p>

<p>4,6-Dimethyl-3-(2-methylphenyl)sulfonyl-1-propan-2-ylpyridin-2-one is a potent and selective inhibitor of protein interactions with the alpha subunit of G protein. It has been shown to be an activator of the beta subunit and a receptor for the alpha subunit. 4,6-Dimethyl-3-(2-methylphenyl)sulfonyl-1-propan-2-ylpyridin-2-one is a high quality chemical that can be used as a research tool in life science, as well as pharmacology, peptides, cell biology, and ion channels.</p>

<p>The PECAM1 antibody is a monoclonal antibody that is water-soluble and specifically targets the PECAM1 protein. It has been shown to be effective in various applications such as diagnostic agents, pharmacologic studies, and life sciences research. The antibody can be used in experiments involving reaction solutions, electrophoresis, and enzyme-linked immunosorbent assays (ELISA). Additionally, it has been used to detect autoantibodies in human serum samples. The PECAM1 antibody is a valuable tool for researchers and scientists looking to study the function and expression of the PECAM1 protein.</p>

<p>Purified Polyclonal Cyclin B3 antibody</p>

<p>IL5RA antibody was raised in Rabbit using Human IL5RA as the immunogen</p>