Biochemicals and Reagents

<p>Haemoglobin protein is a biochemical compound that plays a crucial role in the transport of oxygen in the bloodstream. It consists of four subunits, each containing an iron-containing heme group that binds to oxygen molecules. Haemoglobin protein is responsible for carrying oxygen from the lungs to various tissues and organs in the body.</p>

<p>TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC</p>

<p>CA 19-9 protein is a biomarker that is found in human serum. It can be detected using monoclonal antibodies and has various applications in research and diagnostics. The immobilization of CA 19-9 protein on an electrode surface allows for the development of cytotoxic or neutralizing assays, making it a valuable tool in studying immune responses. Additionally, CA 19-9 protein has antiangiogenic properties, which means it can inhibit the growth of new blood vessels. This makes it relevant in the field of cancer research, where angiogenesis plays a crucial role in tumor growth and metastasis. Furthermore, CA 19-9 protein can be used as a target for drug delivery systems or as a diagnostic marker for diseases such as pancreatic cancer. Its ability to induce lysis of certain cell types also makes it useful in studying cell death pathways and apoptotic processes involving caspase-9. Overall, CA 19-9 protein is an important molecule in the field of life sciences</p>

<p>PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP</p>

<p>CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV</p>

<p>Recombinant Human PRMT3 protein (His tag)</p>

<p>The SIRT5 antibody is a highly specialized monoclonal antibody that plays a crucial role in endothelial growth and blood plasma regulation. This antibody, developed by Life Sciences, is specifically designed to target α-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease.</p>

<p>Purified Polyclonal STAC2 antibody</p>

<p>KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE</p>

<p>Rabbit polyclonal Smad2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to treat tuberculosis infections, this compound exhibits strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been confirmed through extensive testing using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Factor I antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>Mouse monoclonal C2orf40 antibody</p>

<p>ARID3A antibody was raised in mouse using recombinant At Rich Interactive Domain 3A (Bright- Like)</p>

<p>UCP3 antibody was raised in rabbit using a 17 amino acid peptide sequence located at the 2nd and 3rd transmembrane domain of human UCP3 as the immunogen.</p>

<p>The HER3 antibody is a monoclonal antibody known as trastuzumab. It is used in the treatment of certain types of cancer, specifically those that overexpress the HER2 protein. This antibody works by binding to the HER2 receptor on cancer cells, blocking its activity and inhibiting cell growth. The HER3 antibody has been extensively studied and shown to have a high affinity for the HER2 receptor, making it an effective targeted therapy option. In addition, it has also been found to have potential therapeutic applications in other conditions such as autoimmune disorders and cardiovascular diseases. With its specificity and ability to bind to specific targets, the HER3 antibody offers promising possibilities for personalized medicine and targeted treatments.</p>

<p>AAPK-25 is an advanced synthetic compound known as a potassium channel activator, which is derived from extensive pharmacological research. Its mode of action involves selective modulation of certain potassium channels, notably enhancing ion flux across cellular membranes. This modulation is pivotal in influencing electrical excitability and cellular signaling.</p>

<p>Presenilin 1 antibody was raised using the N terminal of PSEN1 corresponding to a region with amino acids TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY</p>

<p>Streptavidin Poly-HRP20 Conjugate for use in immunoassays</p>

<p>The LC3 antibody is a growth factor that is commonly used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to LC3, a protein involved in autophagy. This antibody is highly specific and has been validated for use in various applications, including immunofluorescence, Western blotting, and immunohistochemistry. It can be used to detect the presence of LC3 in samples and study its role in cellular processes. The LC3 antibody is produced using recombinant proteins and has a low-molecular-weight structure, allowing for efficient binding to the target antigen. With its high sensitivity and specificity, this antibody is an essential tool for researchers studying autophagy and related pathways.</p>

<p>The CKLF1 antibody is a highly specialized monoclonal antibody that has been specifically designed to target and neutralize the activated form of CKLF1. This antibody is widely used in the field of Life Sciences for various research purposes, including the study of autoimmune diseases and the development of therapeutic interventions.</p>

<p>Mouse monoclonal ERp31 antibody</p>

<p>Purified recombinant DCX protein (Chicken) (His tag)</p>

<p>JNJ 28871063 hydrochloride is a cationic small molecule that can target cancer cells by binding to overexpressed ICAM-1. It is an experimental drug candidate that has been shown to inhibit tumor growth and reduce the size of tumors in animal models. JNJ 28871063 hydrochloride is also able to selectively cross the blood brain barrier and bind to brain tumor cells, indicating that it may be useful for treating cancers in this area. The drug has been encapsulated in liposomes or hydrogels, which are designed to release the drug at a controlled rate and prevent it from being metabolized before it reaches its target.</p>

<p>The Calcitonin antibody is a Monoclonal Antibody that is used as a diagnostic agent in drug preparation. It is designed to specifically target and neutralize calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively characterized using mass spectroscopy and has been shown to have low density with a high number of acid residues, making it an ideal candidate for surface modification in various Life Sciences applications. In addition, electrochemical impedance spectroscopy has been used to study the binding kinetics of this antibody to calcitonin, further confirming its specificity and efficacy. Whether you are conducting research or developing new therapies, the Calcitonin antibody is an essential tool for your laboratory.</p>

<p>The cMaf antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that targets the protein cMaf, which plays a crucial role in various biological processes. This antibody is widely used in research and diagnostic applications.</p>

<p>5,10,15,20-Tetrakis(4-ethyl-3,5-dimethyl-2H-pyrrol-2-ylidene)methyl]-2,4,6,8-tetrahydroimidazo[1,2a]pyridine (BODIPY FL) is a fluorescent probe for receptor and ligand binding studies. BODIPY FL has been shown to bind to the human serotonin 5HT 1A receptor with high affinity and inhibit the binding of the serotonin antagonist ketanserin. BODIPY FL also binds to the dopamine D 2 receptor with a Kd value of 0.27 nM. It is not active against other receptors or ion channels such as 5HT 2A , 5HT 3 , alpha 1A adrenergic or GABA A receptors.<br>BODIPY FL can be used in fluorescence microscopy and flow cytometry experiments to visualize protein interactions by detecting changes</p>

<p>Rabbit polyclonal BTF3 antibody (FITC)</p>

<p>Di-tert-butyl 5,5'-methylenebis(4-(3-methoxy-3-oxopropyl)-3-methyl-1H-pyrrole-2-carboxylate) is a potent inhibitor of ion channels that are activated by ligands such as glutamate and acetylcholine. It has been shown to inhibit the activity of sodium, potassium, and calcium channels. Di-tert-butyl 5,5'-methylenebis(4-(3-methoxy-3-oxopropyl)-3-methyl-1H--pyrrole--2--carboxylate) is a precursor for the synthesis of peptides and antibodies. This product is offered for research purposes only and not for any clinical use.</p>

<p>Mouse monoclonal HARS2 antibody</p>

<p>Azido-dPEG®12-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>PDM 11 is a virus that infects the optical parameters of radiata pine trees. PDM 11 was first discovered in Australia and has since been found in New Zealand, Chile, and South Africa. This virus has been shown to cause regression of the tree's growth and a decrease in fertility. PDM 11 has been observed to mutate at a frequency of once every 5 years, which may be due to its ability to interconnect with other viruses through a microprocessor. The virus can be detected by using an antenna sensor that predicts future mutations.</p>

<p>RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA</p>

<p>Sapienic acid is a fatty acid that is found in the skin of fish and shellfish. It has been shown to have anti-inflammatory effects in mice with autoimmune diseases by inhibiting the production of inflammatory cytokines, such as tumor necrosis factor. Sapienic acid has also been shown to inhibit insulin resistance in mice by reducing inflammation and increasing insulin sensitivity. This acid also inhibits the growth of bacteria through its ability to inhibit receptor activity and fatty acid biosynthesis. It has been shown to be beneficial for cancer treatment by inhibiting cell proliferation in vitro.</p>

<p>NSC 617145 is a molecule that inhibits leukemia inhibitory factor (LIF) activity by binding to the receptor LIFR. It has been shown to have an apoptotic effect on cells and may be a potential drug target for the treatment of cancer. This compound also has pro-apoptotic properties and can induce mitochondrial membrane depolarization, leading to cell death. NSC 617145 has also been shown to inhibit the production of epidermal growth factor (EGF) in gland cells, which may contribute to its role in tumorigenesis. This compound induces apoptosis in human pathogens such as Helicobacter pylori, Chlamydia pneumoniae, and Candida albicans, but not in normal human cells.</p>

<p>Please enquire for more information about LTV-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LSM14A antibody was raised in Rabbit using Human LSM14A as the immunogen</p>

<p>HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.</p>

<p>Rat monoclonal CD86 antibody (biotin)</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.</p>

<p>KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN</p>

<p>LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH</p>

<p>COCH antibody was raised in rabbit using the N terminal of COCH as the immunogen</p>

<p>The PLOD2 antibody is a highly advanced and specialized product in the field of Life Sciences. It belongs to the category of antibodies and is known for its high-flux inhibitory properties. This antibody is widely used as a serum marker and has been extensively studied as an interferon-stimulated gene. The PLOD2 antibody is designed to specifically target and bind to PLOD2, which is an important enzyme involved in collagen synthesis.</p>

<p>CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THAP5 antibody, catalog no. 70R-4201</p>

<p>Rabbit polyclonal RBM26 antibody</p>

<p>Biotin antibody was raised in rabbit using biotin conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The RPA2 antibody is a highly specific monoclonal antibody that targets acid residues in proteins. It is widely used in life sciences research, particularly in the field of erbb2 inhibition and growth factor signaling. This antibody has been shown to have interferon-like activity and can bind to multiple targets simultaneously, making it a valuable tool in various experimental settings. The RPA2 antibody is commonly used for immunoprecipitation, Western blotting, and flow cytometry applications. Its high affinity and specificity ensure accurate and reliable results. With its unique properties and versatility, the RPA2 antibody is an essential tool for researchers studying protein-protein interactions, signal transduction pathways, and apoptosis-inducing factors.</p>

<p>C4d Complement fragment Monoclonal Antibody (FITC)</p>

<p>SL 0101-1 is a transcriptional regulator that regulates the expression of genes and proteins. It belongs to the family of inhibitors, which are pharmacological agents that inhibit the activity of other drugs or enzymes. This compound is an inhibitor of protein kinase A (PKA) and protein kinase C (PKC). These enzymes regulate cellular processes such as cell growth, differentiation, and survival. SL 0101-1 has been shown to induce mitochondrial membrane depolarization, neuronal death, and inhibition of DNA polymerase activity in cancer tissues. In addition, it inhibits the binding of a nuclear factor to DNA and phosphorylation in neuronal cells.<br>SL 0101-1 also has anti-inflammatory properties by inhibiting cyclooxygenase-2 (COX-2), which is responsible for production of prostaglandins.</p>

<p>m-dPEG®7-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®7-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>TRIM34 antibody was raised in rabbit using the N terminal of TRIM34 as the immunogen</p>

<p>Rabbit polyclonal PFKFB2 antibody</p>

<p>E. coli antibody was raised in mouse using a pool of E. coli serotypes O18, O44, O112 , and O125, as the immunogen.</p>

<p>The BAD antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to the class of inhibitors known as antibodies and has been specifically designed to target c-myc and androgen receptors. This monoclonal antibody has the ability to bind to nuclear proteins and inhibit their activity, making it a valuable tool for studying epidermal growth factor signaling pathways. Additionally, the BAD antibody can be used in protein complex studies, as it can effectively disrupt the interaction between growth factors and their receptors. Whether you're conducting basic research or developing therapeutic strategies, this high-quality antibody is an essential tool for your laboratory.</p>

<p>Purified Polyclonal CHSY2 antibody</p>

<p>Mouse monoclonal SNX8 antibody</p>

<p>Mouse monoclonal DTYMK antibody</p>

<p>The MMP10 antibody is a molecular marker used in Life Sciences research. It is an adeno-associated antibody that specifically targets and inhibits the activity of matrix metalloproteinase 10 (MMP10). MMP10 is involved in various physiological processes, including tissue remodeling, wound healing, and inflammation. By inhibiting MMP10, this antibody can help researchers study the role of this enzyme in different biological systems. It can also be used as a serum marker to monitor MMP10 levels in clinical settings. The MMP10 antibody exhibits high specificity and inhibitory activity against MMP10, making it a valuable tool for studying and understanding the functions of this enzyme.</p>

<p>Phencyclidine m Conjugate for use in immunoassays</p>

<p>TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII</p>

<p>Rabbit polyclonal SYN1 antibody (Ser62)</p>

<p>Biotin-dPEG®11-Lipoamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-Lipoamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Sheep polyclonal Androstanedione antibody</p>

<p>Please enquire for more information about Avanafil-13C5,15N including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-N-Amido-dPEG®3-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®3-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>The SMC1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets myostatin, a protein that regulates muscle growth and development. By binding to myostatin, the SMC1 antibody inhibits its activity, allowing for increased muscle mass and strength. Additionally, this antibody has been shown to have natriuretic effects, promoting the excretion of sodium and water from the body. The SMC1 antibody also interacts with other proteins such as hemoglobin, glp-1, lipoprotein lipase, α-synuclein, elastase protein, and circumsporozoite protein. Its versatility makes it a valuable tool in various fields of research, including molecular biology and immunology.</p>

<p>Rabbit polyclonal UBE2L6 antibody</p>

<p>Pleiotrophin antibody was raised using a synthetic peptide corresponding to a region with amino acids LNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEG</p>

<p>20-COOH-ltb4 is a fatty acid that has been shown to induce chemotaxis in polymorphonuclear leucocytes, which are white blood cells involved in the body's defense against infection. It also induces cell lysis and eosinophil peroxidase activity, which are both proinflammatory responses. 20-COOH-ltb4 has been shown to induce inflammatory bowel disease in rats by inducing the release of reactive oxygen species that cause injury to the colonic epithelium. In addition, 20-COOH-ltb4 has been shown to be effective against bowel disease in mice. This compound binds to the cytosolic protein and inhibits its function by preventing ATP production. 20-COOH-ltb4 also inhibits protein synthesis by binding to adenine nucleotide and diazonium salt.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TEKT4 antibody, catalog no. 70R-3712</p>

<p>Rabbit polyclonal KCNA4 antibody</p>

<p>NARS antibody was raised in mouse using recombinant Asparaginyl-Trna Synthetase</p>

<p>Rabbit polyclonal STMN2 antibody</p>

<p>The LIMK1 antibody is a powerful tool for research and diagnostics. This monoclonal antibody specifically targets and detects activated LIMK1, an important protein involved in cell signaling pathways. It has been extensively validated and is highly specific for human serum samples.</p>

<p>Syk Inhibitor II is an irreversible oxidation agent that is a specific agonist of the Syk protein, which plays a role in inflammatory cytokine production. This compound has been shown to have anti-inflammatory and anti-cancer properties in vitro and in vivo. Syk Inhibitor II inhibits the activation of hematopoietic cells by preventing the binding of mitogenic growth factors to their receptors on the cell surface. It also prevents T-cell lymphomas by inhibiting the proliferation of activated T-cells. Syk Inhibitor II also has been shown to inhibit chronic lymphocytic leukemia by regulating the expression of genes that are important for cell growth and differentiation.</p>

<p>Chiglitazar is a drug that is used for the treatment of metabolic disorders, such as obesity and diabetes. It has been shown to be effective in reducing postprandial plasma triglycerides and cholesterol levels. The pharmacokinetic properties of chiglitazar have been studied with a liquid chromatography-mass spectrometry (LC-MS/MS) method in blood samples from healthy volunteers. The half-life of chiglitazar was found to be about 3 hours. Chiglitazar also has chemotactic activity, which may contribute to its anti-inflammatory effects.</p>

<p>LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE</p>

<p>Bis-dPEG®7-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®7-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>MFSD7 antibody was raised in Rabbit using Human MFSD7 as the immunogen</p>

<p>The UCP2 antibody is a monoclonal antibody that specifically targets hyaluronic acid, a molecule involved in various biological processes. This antibody is commonly used in Life Sciences research and has shown promising results as an anti-mesothelin therapy. It works by binding to mesothelin, a protein highly expressed in certain types of cancer cells, inhibiting their growth and promoting cell death. Additionally, the UCP2 antibody has been found to have inhibitory effects on thrombocytopenia and urokinase plasminogen activator activity in human serum. Its binding to collagen also suggests potential applications in wound healing and tissue regeneration. Furthermore, this antibody has been studied for its role in autoimmune diseases, as it has shown efficacy against autoantibodies and anti-ICOS antibodies. Overall, the UCP2 antibody exhibits cytotoxic properties that make it a valuable tool for researchers and potentially a promising therapeutic option in the future.</p>

<p>The TRAIL antibody is a monoclonal antibody that specifically targets TNF-related apoptosis-inducing ligand (TRAIL). It binds to TRAIL and its binding proteins to form a protein complex, which plays a crucial role in regulating cell growth and survival. The TRAIL antibody has been shown to have cholinergic effects on neuronal cells, enhancing their electrical activity when applied through an electrode. This antibody is widely used in the field of Life Sciences for research purposes and has also shown potential therapeutic applications. It can be used as an antagonist to interfere with the activity of TRAIL or as an agonist to activate TRAIL-mediated signaling pathways. The TRAIL antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs.</p>

<p>SKI-I is a sphingosine kinase inhibitor. SKI-I is an antibody that binds to the protein and inhibits the interaction between sphingosine kinase and its target receptors, ion channels, and other proteins. SKI-I has shown to be a highly pure material with a purity of &gt;99% by HPLC, which can be used as a research tool for cell biology and pharmacology studies.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its potency has been confirmed through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CASP6 antibody was raised in Rabbit using Human CASP6 as the immunogen</p>

<p>Rabbit polyclonal ZNF671 antibody</p>

<p>The CD4 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is used in various fields, including life sciences, to study and detect specific proteins or cells. The CD4 antibody specifically targets and binds to the CD4 antigen, which is expressed on the surface of certain immune cells. This binding can be visualized using techniques such as immunohistochemistry or flow cytometry.</p>

<p>Mouse monoclonal VSIG2 antibody</p>

<p>Fetal Bovine Serum (Heat Inactivated)</p>

<p>Mouse monoclonal CD86 antibody (FITC)</p>

<p>The RBBP9 antibody is a highly specialized monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. This antibody specifically targets RBBP9, a protein that has been found to play a crucial role in several cellular processes.</p>

<p>m-dPEG®12-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®12-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>This Haptoglobin Light Tryptic Peptide Standard has the potential for use in proteomics studies and in the identification and quantitation of proteins. Haptoglobin is involved in the removal of free hemoglobin and also in neutralizing oxidative damage.</p>

<p>6-Methoxy-4-morpholin-4-yl-chromen-2-one is a synthetic compound that acts as an inhibitor of the peptide activator. It binds to the peptide activator and prevents it from binding to its receptor, preventing the activation of the receptor. 6-Methoxy-4-morpholin-4-yl-chromen-2-one has been used as a research tool for investigating protein interactions, antibody production, cell biology, ligand pharmacology and ion channels. This compound has also been shown to be a high purity reagent for use in research laboratories.</p>

<p>Purified Polyclonal TRPS1 antibody</p>

<p>PAX8 antibody was raised in Mouse using a purified recombinant fragment of human PAX8 expressed in E. coli as the immunogen.</p>

<p>Parathyroid Hormone (1-84) N15 Labeled, human, recombinant is a peptide that is used as a research tool in the field of cell biology and pharmacology. It has been shown to inhibit the activity of ion channels and act as an activator for several receptor types. This product is highly purified and can be used in various applications. The CAS number is 51401-06-6.</p>