Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GSK3 α antibody
GSK3 alpha antibody was raised in Mouse using a purified recombinant fragment of GSK3 alpha expressed in E. coli as the immunogen.SGTA protein (His tag)
1-313 amino acids: MDNKKRLAYA IIQFLHDQLR HGGLSSDAQE SLEVAIQCLE TAFGVTVEDS DLALPQTLPE IFEAAATGKE MPQDLRSPAR TPPSEEDSAE AERLKTEGNE QMKVENFEAA VHFYGKAIEL NPANAVYFCN RAAAYSKLGN YAGAVQDCER AICIDPAYSK AYGRMGLALS SLNKHVEAVA YYKKALELDP DNETYKSNLK IAELKLREAP SPTGGVGSFD IAGLLNNPGF MSMASNLMNN PQIQQLMSGM ISGGNNPLGT PGTSPSQNDL ASLIQAGQQF AQQMQQQNPE LIEQLRSQIR SRTPSASNDD QQELEHHHHH HPurity:Min. 95%ACTB antibody
The ACTB antibody is a highly specialized monoclonal antibody that offers a range of benefits in the field of life sciences. This antibody is specifically designed to target and neutralize the growth factor known as saponin, which plays a crucial role in various cellular processes. By binding to saponin, this antibody effectively inhibits its activity and prevents its interaction with other molecules.
LPL antibody
The LPL antibody is a highly specialized chemical agent used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to lipoprotein lipase (LPL), a glycoprotein involved in lipid metabolism. This antibody has been extensively studied and proven to be highly effective in various applications.ODC1 antibody
The ODC1 antibody is a monoclonal antibody that specifically targets the polypeptide sequences of ODC1. It has been extensively used in Life Sciences research to study the role of ODC1 in various biological processes. This antibody has shown high affinity and specificity for ODC1 and has been widely used in nuclear and colloidal protein assays. Additionally, it has been used to detect and measure the levels of ODC1 in samples, making it an invaluable tool for researchers working with growth factors, morphogenetic proteins, and erythropoietin. Whether you are studying proteinase activity or investigating the effects of sclerostin on cellular function, the ODC1 antibody is an essential component for your research. Choose this high-quality antibody to ensure accurate and reliable results in your experiments.ALOX15B antibody
ALOX15B antibody was raised using the middle region of ALOX15B corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIPurity:Min. 95%Cytokeratin 84 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KRT84 antibody, catalog no. 70R-3002
Purity:Min. 95%Vaccinia Virus antibody
The Vaccinia Virus antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the Vaccinia virus, which is a member of the poxvirus family. This antibody recognizes a conformational epitope on the surface of the virus and has been shown to have high neutralizing activity.SLFN12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLFN12 antibody, catalog no. 70R-4360Purity:Min. 95%SPOP antibody
SPOP antibody was raised in rabbit using the C terminal of SPOP as the immunogenPurity:Min. 95%COMMD8 antibody
COMMD8 antibody was raised in rabbit using the middle region of COMMD8 as the immunogenPurity:Min. 95%CANX antibody
CANX antibody was raised in rabbit using the middle region of CANX as the immunogenPurity:Min. 95%NGAL antibody
The NGAL antibody is a monoclonal antibody used in Life Sciences research. It is commonly used in immunoassays to detect and quantify NGAL (Neutrophil Gelatinase-Associated Lipocalin) levels in human serum. This antibody has high specificity and sensitivity, making it ideal for accurate and reliable measurements. The NGAL antibody can also be used in assays to detect autoantibodies or anti-drug antibodies. It is buffered and stable, ensuring consistent performance in various experimental conditions. Additionally, this antibody can be conjugated with different markers such as carbon quantum dots or colloidal gold for visualization purposes. Whether you are studying kidney diseases, inflammation, or drug development, the NGAL antibody is an essential tool for your research needs.Pfkfb2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pfkfb2 antibody, catalog no. 70R-9421
Purity:Min. 95%PHF12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHF12 antibody, catalog no. 70R-8895Purity:Min. 95%ANKRD11 antibody
ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIRLaminin γ 1 antibody
The Laminin Gamma 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the laminin gamma 1 protein, which plays a crucial role in cell adhesion and migration. By blocking the activity of this protein, the antibody can inhibit the formation of new blood vessels, known as microvessel density, which is essential for tumor growth and metastasis. Additionally, this antibody has been shown to activate phosphatase enzymes, which are involved in regulating cellular processes such as signal transduction and gene expression. The Laminin Gamma 1 antibody can be used in various applications, including immunohistochemistry and Western blotting, to study the role of laminin gamma 1 in different biological systems. Researchers can also use this antibody to investigate potential therapeutic targets for diseases involving abnormal angiogenesis or aberrant cell adhesion.RBBP6 antibody
RBBP6 antibody was raised using the N terminal of RBBP6 corresponding to a region with amino acids APPVSGNPSSAPAPVPDITATVSISVHSEKSDGPFRDSDNKILPAAALAS
Purity:Min. 95%Goat anti Human IgG + IgA + IgM (rhodamine)
This antibody reacts with kappa light chains on human immunoglobulins.
Purity:Min. 95%Nucleobindin 1 antibody
Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHLPurity:Min. 95%Rabbit anti Goat IgG (rhodamine)
Rabbit anti-goat IgG (Rhodamine) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%FSTL5 antibody
FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMECHDC2 antibody
ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI
Purity:Min. 95%AGPAT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AGPAT2 antibody, catalog no. 70R-1770Purity:Min. 95%SLC25A31 antibody
SLC25A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIPPurity:Min. 95%GRK6 antibody
The GRK6 antibody is a highly specialized protein that plays a crucial role in regulating cellular processes. It specifically targets alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. By binding to alpha-synuclein, the GRK6 antibody prevents its aggregation and cytotoxic effects, ultimately promoting cell survival.FBXO33 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO33 antibody, catalog no. 70R-3799Purity:Min. 95%PDIA4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective among the rifamycins in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using a patch-clamp technique on human erythrocytes.CLIC5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel5 antibody, catalog no. 70R-1515Purity:Min. 95%PSMA5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA5 antibody, catalog no. 70R-4325Purity:Min. 95%Uap1l1 antibody
Uap1l1 antibody was raised in rabbit using the middle region of Uap1l1 as the immunogenPurity:Min. 95%BCAS2 antibody
BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
PCSK9 antibody
The PCSK9 antibody is a growth factor protein that acts as an inhibitory factor for epidermal growth factor (EGF) and hepatocyte growth factor (HGF). It is a monoclonal antibody that specifically targets and neutralizes PCSK9, a protein involved in the regulation of cholesterol metabolism. By blocking PCSK9, this antibody helps to lower LDL cholesterol levels in the blood, reducing the risk of cardiovascular diseases. The PCSK9 antibody can be used in various research applications such as enzyme-linked immunosorbent assay (ELISA), Western blotting, immunohistochemistry (IHC), and flow cytometry. With its high specificity and affinity, this antibody provides accurate and reliable results for cholesterol-related studies.
Goat anti Human IgG (biotin)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%GABARAPL2 antibody
GABARAPL2 antibody was raised in rabbit using the C terminal of GABARAPL2 as the immunogenPurity:Min. 95%14-3-3 antibody
The 14-3-3 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study various cellular processes. This antibody specifically targets the 14-3-3 isoforms, a group of proteins involved in signal transduction, cell cycle regulation, and apoptosis.
Aquaporin 10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AQP10 antibody, catalog no. 70R-7450
Purity:Min. 95%STS antibody
STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWAnnexin A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA11 antibody, catalog no. 70R-1702Purity:Min. 95%NLRP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NLRP1 antibody, catalog no. 70R-2731Purity:Min. 95%Follistatin antibody
The Follistatin antibody is a monoclonal antibody that targets and binds to Follistatin, a protein involved in various biological processes. Follistatin plays a crucial role in regulating the activity of growth factors such as glucagon and colony-stimulating factors (CSFs). By binding to Follistatin, this antibody inhibits its function and prevents it from interacting with its binding proteins. This inhibition can have several effects on different systems in the body.BXDC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BXDC2 antibody, catalog no. 70R-9483Purity:Min. 95%DDX21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX21 antibody, catalog no. 70R-1368
Purity:Min. 95%ILF3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA9 antibody, catalog no. 70R-8082Purity:Min. 95%PGBD3 antibody
PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLTPPME1 antibody
PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFThrombopoietin antibody
Thrombopoietin antibody is a highly specialized antibody that is used in the field of life sciences. It is designed to target and bind to thrombopoietin, a protein found in human serum. This antibody plays a crucial role in regulating platelet production and function.RAD23B antibody
RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPCUGBP2 antibody
CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFVCEACAM19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM19 antibody, catalog no. 70R-6300Purity:Min. 95%
