Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-1477</p>

<p>RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL</p>

<p>Purified Polyclonal SP3/4 antibody</p>

<p>The S6K1 antibody is a monoclonal antibody used in Life Sciences. It acts as an anticoagulant by neutralizing the binding proteins involved in blood clotting. This antibody targets specific glycosylation sites on activated proteins, preventing them from forming clots. In addition to its anticoagulant properties, the S6K1 antibody can also be used in research and diagnostic applications. It has been shown to inhibit the activity of colony-stimulating factors and interleukin-6, which are involved in inflammation and immune responses. Furthermore, this antibody has demonstrated its ability to bind to fibrinogen and glycopeptides, providing insights into their structure and function. While it offers numerous benefits, it is important to note that the S6K1 antibody should be handled with care due to its potential toxic effects. For researchers and scientists seeking reliable antibodies for their experiments, the S6K1 antibody is a valuable tool in understanding various biological processes and pathways.</p>

<p>The ITGA5 antibody is a growth factor antibody that plays a crucial role in the field of Life Sciences. It specifically targets and neutralizes interleukin-6 (IL-6), an important cytokine involved in various physiological processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is highly active in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Vimentin antibody was raised using the N terminal of VIM corresponding to a region with amino acids LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX49 antibody, catalog no. 70R-1308</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP91 antibody, catalog no. 20R-1106</p>

<p>DNAI2 antibody was raised in rabbit using the N terminal of DNAI2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTN4 antibody, catalog no. 70R-7137</p>

<p>Purified recombinant MYLPF protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMPO antibody, catalog no. 70R-6298</p>

<p>The KLK2 antibody is a monoclonal antibody that specifically targets the KLK2 protein in human serum. This antibody has been extensively studied and characterized using various techniques, such as molecular docking and polymerase chain reaction (PCR). It has shown high specificity and affinity for the KLK2 protein, making it an ideal tool for research in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KREMEN1 antibody, catalog no. 70R-6267</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MIS12 antibody, catalog no. 70R-5558</p>

<p>E2f7 antibody was raised in rabbit using the N terminal of E2F7 as the immunogen</p>

<p>Purified recombinant ATP1B3 protein (His tag)</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. It belongs to the group of Polyclonal Antibodies and has cytotoxic properties. This antibody specifically targets AKT1, a protein involved in various cellular processes such as cell growth, proliferation, and survival. By binding to AKT1, this antibody inhibits its activity and prevents downstream signaling pathways from being activated.</p>

<p>The GCF antibody is a growth factor that belongs to the family of monoclonal antibodies. It has been shown to inhibit the activity of various proteins involved in cell growth, including adalimumab, anti-VEGF, and trastuzumab. The GCF antibody has been extensively studied in the field of life sciences and has demonstrated its effectiveness in inhibiting the growth of various cell types, including MCF-7 and endothelial cells. This antibody can be used as a research tool for studying protein interactions and signaling pathways related to cell growth. Additionally, it has shown potential therapeutic applications in targeting specific proteins, such as keratinocyte growth factor and CD33. With its versatile properties and wide range of applications, the GCF antibody is a valuable tool for researchers in various fields.</p>

<p>NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF</p>

<p>MARK2 antibody was raised in Rabbit using Human MARK2 as the immunogen</p>

<p>Rabbit anti-rat IgG (H+L) (FITC) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal SCYE1 antibody</p>

<p>Rabbit polyclonal Arrestin 1 antibody (Ser412)</p>

<p>Goat anti-bovine IgG (Rhodamine) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>Rabbit Polyclonal FOXD4D4 antibody</p>

<p>The Creatine Kinase Antibody is an acidic antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets the circumsporozoite protein, an antigen found in various organisms. This antibody has been widely used in studies related to growth factors, neuroprotection, and platelet-derived growth. It can be utilized in immunoassays, such as enzyme-linked immunosorbent assays (ELISA), western blotting, and immunohistochemistry. The Creatine Kinase Antibody offers high specificity and sensitivity, making it a valuable tool for researchers in the field. Whether you're studying cellular pathways or investigating disease mechanisms, this antibody will provide reliable results and contribute to advancements in scientific knowledge.</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen</p>

<p>Hamster Red Blood Cells are biospecimens commonly used in various veterinary applications and life sciences research. These cells are reactive and can be utilized for a wide range of experiments, including immunohistochemical detection, electrophoresis, and antigen binding assays. Hamster Red Blood Cells contain collagen and taurine, which makes them suitable for studying the interaction between collagen gel and ginsenoside or other compounds. They can also be used to investigate the effects of monoclonal antibodies or interleukin-6 on cell function. With their diverse applications, Hamster Red Blood Cells are an essential tool for researchers in the field of life sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf174 antibody, catalog no. 70R-3593</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC3207 antibody, catalog no. 70R-10082</p>

<p>RFPL4B antibody was raised using the middle region of RFPL4B corresponding to a region with amino acids EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA</p>

<p>Purified recombinant TGF beta 1 protein (His tag)</p>

<p>OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL</p>

<p>IP10 antibody was raised in rabbit using highly pure recombinant human IP-10 as the immunogen.</p>

<p>AGPAT6 antibody was raised in Rabbit using Human AGPAT6 as the immunogen</p>

<p>Bacillus anthracis (anthrax) antibody was raised in mouse using protective antigen of Bacillus anthracis as the immunogen.</p>

<p>The MOK antibody is a polyclonal antibody that specifically targets sclerostin, an important regulator of bone metabolism. This antibody is commonly used in research and diagnostic applications, such as immunohistochemistry and western blotting. It binds to sclerostin with high affinity, allowing for accurate detection and quantification of this protein in various samples.</p>

<p>DNMT3B antibody was raised using a synthetic peptide corresponding to a region with amino acids GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC</p>

<p>Mouse monoclonal NEK11 antibody</p>

<p>Fibrinopeptide A antibody was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL3 antibody, catalog no. 70R-7392</p>

<p>PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA). It is a growth factor that plays a crucial role in the development and progression of prostate cancer. This antibody works by binding to PSA, preventing its interaction with other molecules and inhibiting its function. In addition to its anti-cancer properties, PSA antibody also exhibits antiangiogenic effects, meaning it can inhibit the formation of new blood vessels that supply nutrients to tumors. This makes it a promising therapeutic option for the treatment of prostate cancer. Furthermore, PSA antibody has been studied for its potential use in other medical conditions such as heparin-induced thrombocytopenia and natriuretic disorders. With its specificity and efficacy, PSA antibody is at the forefront of advancements in Life Sciences and holds great promise for improving patient outcomes.</p>

<p>EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL</p>

<p>Butyrophilin antibody was raised in Guinea Pig using Butyrophilin purified from bovine milk fat globule membrane as the immunogen.</p>

<p>NFKB P65 rel A antibody was raised in rabbit using NFkB p65 (Rel A) peptide corresponding to a region near the C-terminus of the human protein conjugated to KLH as the immunogen.</p>

<p>Purified recombinant CNPY1 protein (His tag)</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>PARP10 antibody was raised in rabbit using the N terminal of PARP10 as the immunogen</p>

<p>Purified Polyclonal RAB14 antibody</p>

<p>Armenian Hamster monoclonal CD11c antibody (biotin)</p>

<p>Rabbit polyclonal OR9G1 antibody</p>

<p>Rat gamma 2B heavy chain antibody was raised in mouse using rat IgG2b as the immunogen.</p>

<p>Purified recombinant NUP62CL protein (His tag)</p>

<p>INPP5B antibody was raised using the middle region of INPP5B corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN</p>

<p>CD49E antibody was raised in hamster using mouse/rat CD49 as the immunogen.</p>

<p>MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE</p>

<p>Mouse monoclonal Ghrelin antibody (Biotin)</p>

<p>Purified recombinant Human EIF1B protein</p>

<p>KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV</p>

<p>Purified Polyclonal CABLES1 antibody</p>

<p>FNIP1 Antibody</p>

<p>Rat monoclonal CD90.2 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC732272 antibody, catalog no. 70R-9042</p>

<p>Rabbit polyclonal RIMS4 antibody</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:</p>

<p>Mouse monoclonal ANAPC2 antibody</p>

<p>UBXD2 antibody was raised in rabbit using the middle region of UBXD2 as the immunogen</p>

<p>Mouse monoclonal CD11a antibody</p>

<p>Purified Rabbit polyclonal CLASP1 antibody</p>

<p>Mouse monoclonal PPWD1 antibody</p>

<p>Syk Inhibitor is a small molecule compound designed to inhibit the activity of spleen tyrosine kinase (Syk), which is derived through advanced chemical synthesis from a variety of organic substrates. With its mode of action as a kinase inhibitor, Syk Inhibitor functions by specifically binding to the ATP-binding site of the Syk enzyme. This binding effectively blocks the phosphorylation processes necessary for signal transduction pathways that are critical in immune cell activation and function.</p>

<p>Purified Rabbit polyclonal TFII-I antibody (Tyr248)</p>

<p>The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying the role of androgen receptors in various biological processes. This polyclonal antibody specifically targets and binds to the androgen receptor, a protein involved in the regulation of gene expression.</p>

<p>The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.</p>

<p>2,2,2-Trichloro-1-(2-chlorophenyl)ethanone is a potent anticancer agent that has been shown to inhibit the growth of human and Chinese hamster cancer cells. It works by inhibiting the cell cycle and inducing apoptosis in tumor cells. This medicinal compound is a kinase inhibitor that targets specific proteins involved in cancer cell growth and division. 2,2,2-Trichloro-1-(2-chlorophenyl)ethanone has been found to be effective against various types of cancers and is being studied as a potential treatment option. It can also be detected in urine samples and may serve as a biomarker for exposure to this compound. Overall, this inhibitor shows great promise as a potential therapeutic option for cancer treatment.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>C9ORF127 antibody was raised using the N terminal Of C9Orf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>DAAO protein is a versatile agent and/or hepatocyte growth factor that plays a crucial role in various biological processes. It contains disulfide bonds, which contribute to its stability and functionality. This protein is widely studied in the field of Life Sciences, particularly in the areas of Proteins and Antigens. DAAO protein has been found to have neutralizing effects on aldosterone, making it potentially valuable in the development of aldosterone antagonists. Monoclonal antibodies targeting DAAO protein have been developed for research purposes, such as detecting its expression levels or investigating its interactions with other molecules. Additionally, DAAO protein has been associated with CYP2A6, an enzyme involved in drug metabolism. Its presence can be detected using polymerase chain reaction (PCR) techniques. Recent studies have also suggested a potential link between DAAO protein and choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. Furthermore, researchers are exploring the</p>

<p>Rabbit polyclonal MPO antibody (Prediluted for IHC)</p>

<p>Rabbit anti-cat IgG (HRP) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>MRPL48 antibody was raised in Rabbit using Human MRPL48 as the immunogen</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND</p>

<p>The BHMT antibody is a highly specialized antibody used in Life Sciences research. It targets the BHMT protein, which plays a crucial role in various biological processes. The BHMT antibody has been shown to have neutralizing properties against the fibronectin, cholinergic, insulin, and collagen pathways. This makes it an essential tool for studying the interactions between these proteins and their associated functions.</p>

<p>PINK1 protein is a key player in cellular processes and has been studied extensively in the field of Life Sciences. It is involved in various functions, including the regulation of mesenchymal stem cells and collagen production. PINK1 protein has been utilized for ultrasensitive detection in human serum using electrochemical impedance spectroscopy, making it a valuable tool for diagnostic purposes. Additionally, recombinant proteins and monoclonal antibodies targeting PINK1 have been developed for research applications. These antibodies have shown neutralizing properties against reactive forms of PINK1, further highlighting their potential therapeutic significance. With its unique characteristics and applications, PINK1 protein continues to contribute to advancements in the field of Life Sciences.</p>

<p>Rabbit polyclonal RAB33A antibody</p>

<p>Rabbit polyclonal MAN1B1 antibody</p>

<p>IGFBP1 antibody was raised in Rabbit using Human IGFBP1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal gamma Actin antibody</p>

<p>NEIL3 antibody was raised in mouse using recombinant Human Nei Endonuclease Viii-Like 3 (E. Coli)</p>

<p>Rabbit polyclonal TUBGCP3 antibody</p>

<p>PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL</p>

<p>Rabbit polyclonal TRIM28 antibody (biotin)</p>

<p>Purified Polyclonal DFF45 antibody</p>

<p>Mouse monoclonal TUBA8 antibody</p>

<p>PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP</p>