Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,559 products)
- By Biological Target(101,029 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Goat anti Rat IgG (H + L) (rhodamine)
Goat anti-rat IgG (H+L) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%Goat anti Chicken IgY (H + L) (biotin)
Goat anti Chicken IgY secondary antibody (Biotin)Purity:Min. 95%HEV ORF2 antibody
The HEV ORF2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ORF2 protein of the hepatitis E virus (HEV), which is responsible for viral replication and assembly. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and ELISA assays.Ret antibody
Ret antibody was raised in Mouse using a purified recombinant fragment of Ret(aa896-1063) expressed in E. coli as the immunogen.SEMA4F antibody
SEMA4F antibody was raised using the N terminal of SEMA4F corresponding to a region with amino acids PLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV
Purity:Min. 95%PSG1 antibody
PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLEENO2 antibody
The ENO2 antibody is a highly specialized immunosuppressant that targets protein-protein interactions. It specifically binds to ENO2 dimers, which play a crucial role in various cellular processes. This monoclonal antibody has been extensively studied and characterized for its ability to inhibit the activity of ENO2, thereby preventing its interaction with other molecules.LKB1 antibody
The LKB1 antibody is a polyclonal antibody that specifically targets the growth factor LKB1. It has a high affinity for LKB1 and can be used in various research applications. This antibody has been shown to bind to serum albumin, making it suitable for use in immunohistochemistry and immunofluorescence assays. Additionally, the LKB1 antibody can detect glutamate, actin, and cytotoxic molecules in samples, making it a versatile tool for studying cellular processes. It is also available as a monoclonal antibody for more specific applications. The LKB1 antibody is activated by sulphates present in human serum, allowing for accurate detection of LKB1 levels in biological samples. In the field of Life Sciences, this antibody is commonly used to study autoantibodies and phosphatase activity. Its ability to label actin filaments makes it particularly useful for visualizing cytoskeletal structures.RGS10 antibody
RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNTLARP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LARP7 antibody, catalog no. 70R-4953Purity:Min. 95%CRABP2 protein
1-138 amino acids: MPNFSGNWKI IRSENFEELL KVLGVNVMLR KIAVAAASKP AVEIKQEGDT FYIKTSTTVR TTEINFKVGE EFEEQTVDGR PCKSLVKWES ENKMVCEQKL LKGEGPKTSW TRELTNDGEL ILTMTADDVV CTRVYVRE
Purity:Min. 95%Rabbit anti Goat IgG (H + L) (HRP)
Rabbit anti-Goat IgG (H + L) (HRP) was raised in rabbit using purified Goat IgG (H&L) as the immunogen.Purity:Min. 95%Rabbit anti Goat IgG (H + L)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Purity:Min. 95%DMRTC2 antibody
DMRTC2 antibody was raised in rabbit using the N terminal of DMRTC2 as the immunogenPurity:Min. 95%PLC beta 2 antibody
The PLC beta 2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a low-molecular-weight antibody that specifically targets PLC beta 2, an important protein involved in cell signaling pathways. This antibody is commonly used in research and diagnostic applications to study the role of PLC beta 2 in various biological processes.HNRNPA2B1 antibody
HNRNPA2B1 antibody was raised using the N terminal of HNRNPA2B1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
p38 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.Purity:Min. 95%KCNG4 antibody
KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRPPurity:Min. 95%Ribophorin II antibody
Ribophorin II antibody was raised using the N terminal of RPN2 corresponding to a region with amino acids ASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVAPurity:Min. 95%CREB antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to be highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its efficacy has been proven through various scientific techniques such as patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%KLK-BL4 antibody
KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
SNAP25 antibody
SNAP25 antibody was raised in mouse using recombinant human SNAP25 (1-206aa) purified from E. coli as the immunogen.DAZAP1 antibody
DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVADNAJA2 antibody
DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMZNF674 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF674 antibody, catalog no. 70R-8900Purity:Min. 95%SMS antibody
The SMS antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a wide range of applications, including the study of fibrinogen and annexin proteins. This antibody is commonly used in experiments involving electrodes and has been proven to be effective in detecting and quantifying cortisol levels. Additionally, the SMS antibody has shown promising results as a family kinase inhibitor, making it a valuable tool for studying dopamine and growth factor signaling pathways. Its specificity and high affinity make it an ideal choice for researchers working with tyrosine antibodies, mcf-7 cells, cephalosporins, and inhibitors. With its versatility and reliability, the SMS antibody is an essential component in various scientific investigations.IMP5 antibody
IMP5 antibody was raised using the middle region of IMP5 corresponding to a region with amino acids NPGEDTTEIVTISENEATNPEDRSDSSEGWSDAHLDPNELPFIPPGASEEPurity:Min. 95%UNQ1887 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UNQ1887 antibody, catalog no. 70R-4578
Purity:Min. 95%PDP2 antibody
PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDFlt3 Ligand antibody
Flt3 Ligand antibody was raised using the N terminal of FLT3LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYPurity:Min. 95%ADAM8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM8 antibody, catalog no. 70R-9938Purity:Min. 95%GNAQ antibody
GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKPurity:Min. 95%PRDM9 antibody
PRDM9 antibody was raised in rabbit using the middle region of PRDM9 as the immunogenPurity:Min. 95%ARC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARC antibody, catalog no. 70R-8315Purity:Min. 95%PSMC4 antibody
PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQECyyr1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Cyyr1 antibody, catalog no. 70R-8636
Purity:Min. 95%Staphylococcus aureus antibody (FITC)
Staphylococcus aureus antibody (FITC) was raised in rabbit using ATCC 27660 as the immunogen.HFE antibody
HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWPurity:Min. 95%Cytokeratin 24 antibody
Cytokeratin 24 antibody was raised using the middle region of KRT24 corresponding to a region with amino acids GSVNMGSRDLVSGDSRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVFLJ20489 antibody
FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKVPurity:Min. 95%APJ antibody
The APJ antibody is a highly versatile and effective tool used in Life Sciences research. This colloidal antibody is designed to specifically target and bind to the APJ protein, a key regulator in various cellular processes. The APJ antibody is commonly used in studies involving biomolecules, such as epidermal growth factor and growth factors, to investigate their interactions and signaling pathways.Purity:Min. 95%Akt antibody (Ser129)
Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.ASH2L antibody
ASH2L antibody was raised in mouse using recombinant Human Ash2 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash2L)Rabbit anti Bovine IgG
Rabbit anti-bovine IgG was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%TMEM135 antibody
TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
Purity:Min. 95%VEGFR3 antibody
The VEGFR3 antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and neutralize the activity of VEGFR3, a protein kinase involved in endothelial growth and development. This antibody is derived from Polyclonal Antibodies, ensuring high specificity and potency.Purity:Min. 95%HRB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HRB antibody, catalog no. 70R-4741Purity:Min. 95%HECTD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HECTD2 antibody, catalog no. 70R-2368
Purity:Min. 95%KBTBD10 antibody
KBTBD10 antibody was raised in rabbit using the C terminal of KBTBD10 as the immunogenPurity:Min. 95%AKAP7 antibody
AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNRRAS2 protein (His tag)
1-201 amino acids: MGSSHHHHHH SSGLVPRGSH MAAAGWRDGS GQEKYRLVVV GGGGVGKSAL TIQFIQSYFV TDYDPTIEDS YTKQCVIDDR AARLDILDTA GQEEFGAMRE QYMRTGEGFL LVFSVTDRGS FEEIYKFQRQ ILRVKDRDEF PMILIGNKAD LDHQRQVTQE EGQQLARQLK VTYMEASAKI RMNVDQAFHE LVRVIRKFQE QECPPSPEPT RKEKDKKGCH CPurity:Min. 95%LMF1 antibody
LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWPurity:Min. 95%AHCYL1 antibody
AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIECSK antibody
The CSK antibody is a highly reactive and neutralizing antibody that targets the activated form of calmodulin. This polyclonal antibody is widely used in life sciences research, particularly in studies related to growth factors and adipose tissue. It has also been shown to have a neutralizing effect on influenza hemagglutinin, making it a valuable tool for studying viral infections. The CSK antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit the activity of calmodulin-dependent enzymes such as 3-kinase and solute diuretic, this antibody offers great potential for further understanding cellular signaling pathways.Purity:Min. 95%FABP3 antibody
FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
TIMP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIMP3 antibody, catalog no. 70R-9697Purity:Min. 95%ANKRD5 antibody
ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRALZTFL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LZTFL1 antibody, catalog no. 70R-1291Purity:Min. 95%GALR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALR2 antibody, catalog no. 70R-10309
Purity:Min. 95%GILZ antibody
The GILZ antibody is a growth factor that has been widely used as a diagnostic agent in various fields of research, including Life Sciences. It is a cationic antibody that exhibits strong biological effects and can be used as a fluorescent probe or photocatalytic agent. The GILZ antibody is typically conjugated with pluronic p123 to enhance its particle chemiluminescence properties. This monoclonal antibody specifically targets and binds to the antigen binding domain, allowing for accurate detection and analysis of specific molecules or proteins. With its activated state and high affinity for target antigens, the GILZ antibody provides researchers with a powerful tool for studying cellular processes and identifying potential therapeutic targets.CREB3L1 antibody
CREB3L1 antibody was raised in rabbit using the N terminal of CREB3L1 as the immunogenPurity:Min. 95%FZD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD5 antibody, catalog no. 70R-7475Purity:Min. 95%TRAK1 antibody
TRAK1 antibody was raised in rabbit using the middle region of TRAK1 as the immunogenPurity:Min. 95%TRPV4 antibody
TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRPurity:Min. 95%
