Biochemicals and Reagents

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR</p>

<p>Tulopafant is a novel linker drug that has shown efficacy in treating ischemia/reperfusion injury. It acts by binding to and activating neutrophils, which are important for the body's immune response to infection. Tulopafant promotes the release of reactive oxygen species from neutrophils, and it also neutralizes reactive nitrogen species. This drug has been shown to be effective in reducing ventricular fibrillation in vitro studies and may be useful as a treatment for myocardial infarcts.</p>

<p>Rabbit polyclonal WNT7A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>

<p>Purified Rabbit polyclonal GRAP antibody</p>

<p>The Cry1Ab antibody is a cytotoxic monoclonal antibody that targets the tyrosine kinase activity of the glucose transporter. It has been extensively studied in Life Sciences and has shown promising results in various applications. The Cry1Ab antibody specifically binds to activated protein kinases and inhibits their function, leading to a decrease in cell proliferation and survival. Additionally, this antibody has been shown to inhibit collagen synthesis, making it a potential therapeutic option for diseases characterized by excessive collagen production. Furthermore, the Cry1Ab antibody has also demonstrated efficacy as an anti-CD20 antibody in preclinical studies, suggesting its potential use in treating B-cell malignancies. In vitro experiments have shown that this antibody effectively neutralizes its target and exhibits minimal cross-reactivity with other proteins present in human serum. With its unique mechanism of action and promising preclinical data, the Cry1Ab antibody holds great potential for future therapeutic development.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>The EIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (EIF4E). This glycoprotein plays a crucial role in the regulation of protein synthesis and is involved in various cellular processes. The antibody specifically recognizes and binds to EIF4E dimers, inhibiting its activity and preventing the initiation of translation.</p>

<p>16:0-18:1 Diether PG is a synthetic lipid, which is derived from chemically modified glycerophospholipids. Its structure involves two ether-linked alkyl chains, with one saturated (16:0) and one monounsaturated (18:1) chain. This compound does not occur naturally but is synthesized for research purposes to mimic certain biological membrane properties.</p>

<p>IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.</p>

<p>The RPE65 antibody is a monoclonal antibody that has been extensively used in Life Sciences research. It specifically targets the RPE65 protein, which plays a crucial role in the visual cycle and is involved in the regeneration of visual pigments. The RPE65 antibody has been proven to be highly specific and sensitive in detecting RPE65 expression in various tissues and cell types.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Cyclosporin A-derivative 1 is a peptide that has been used as a research tool in cell biology and pharmacology. Cyclosporin A-derivative 1 is an activator of ion channels, which are proteins found in the membranes of cells that regulate the flow of ions across the membrane. It has also been shown to inhibit protein interactions and receptor binding, as well as having ligand activity. Cyclosporin A-derivative 1 binds to Ligand-gated ion channels and inhibits the opening of these channels.</p>

<p>GPR120 modulator 1 is a peptide that belongs to the class of protein interactions. It is an inhibitor that functions by binding to the receptor for G-protein coupled receptors 120 (GPR120) and blocking its activation. This product can be used as a research tool or as an antibody. GPR120 modulator 1 has been shown to inhibit ion channels and activate GPR120.</p>

<p>The CD11a antibody is a monoclonal antibody that specifically targets the CD11a protein. CD11a is an activated growth factor that plays a crucial role in various biological processes. This antibody has been extensively studied and has shown high affinity and specificity for CD11a.</p>

<p>Nrf2-IN-1 is a small molecule that has been shown to increase the glomerular filtration rate in rats. It also enhances renal function by reducing urea nitrogen and staining. In addition, Nrf2-IN-1 protects against renal injury caused by ischemia reperfusion injury in rats. Nrf2-IN-1 also prevents oxidative injury of kidney cells and reduces cell apoptosis. This drug has been shown to reduce inflammation by inhibiting tumor necrosis factor α (TNFα) production in mice with acute kidney injury.</p>

<p>GNF4877 is an oral medication that has been shown to enhance the ability of insulin-producing cells, called β-cells, to produce and release insulin in response to glucose levels. This drug selectively inhibits the kinase activity of a growth factor receptor called "growth factor receptor β" (GRβ), which is found on the surface of cells. The inhibition of GRβ leads to increased production of a protein called "effector protein 1" (E1P1) in pancreatic β-cells. Increased E1P1 enhances glucose uptake and stimulates the production and release of insulin by β-cells, which can be used as an alternative treatment for diabetes mellitus type 2.</p>

<p>PS372424 hydrochloride is a peptide that has been shown to be an activator of the high-affinity receptor for the neurotransmitter GABA. PS372424 hydrochloride interacts with and activates GABAA receptors, which are ligand-gated chloride channels. These channels are involved in regulating neuronal excitability and postsynaptic inhibition in the central nervous system. PS372424 hydrochloride has also been shown to inhibit both potassium and calcium currents, suggesting that it may modulate neuronal activity in other parts of the body as well.</p>

<p>Recombinant human TNF-α</p>

<p>Please enquire for more information about 2,3-Dihydroxy-1-(1H-indol-3-yl)propyl tryptophan including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT</p>

<p>Purified native Human CA 72-4 protein</p>

<p>Purified Polyclonal NF kappaB p105/p50 antibody</p>

<p>DCG IV is a sophisticated fourth-generation tyrosine kinase inhibitor, which is synthesized through advanced medicinal chemistry techniques. Its mode of action involves the selective targeting and inhibition of specific tyrosine kinases that are aberrantly active in certain malignancies. By binding to the ATP-binding sites of these kinases, DCG IV effectively disrupts the signaling pathways that are crucial for cancer cell proliferation and survival.</p>

<p>1-(2-Phenylpropan-2-yl)piperidine hydrochloride is a chemical compound categorized as a piperidine derivative. Piperidines are a class of organic compounds based on a six-membered ring containing five carbon atoms and one nitrogen atom. This particular compound is synthesized through a series of chemical reactions involving its precursor piperidine, and then combined with hydrochloric acid to form its hydrochloride salt, which increases its solubility and stability.</p>

<p>Mouse monoclonal TFDP1 antibody</p>

<p>RNP protein is a recombinant protein produced in E. coli, which is used as a marker for mixed connective tissue disease (MCTD). It is a component of U1-RNP, a ribonucleoprotein complex that contains the antigen recognized by anti-U1-ribonucleoprotein antibody. RNP protein can be used to detect and quantify MCTD in serum samples. This purified recombinant protein is suitable for use in Life Sciences research, Proteins and Antigens applications.</p>

<p>Purified recombinant SULT1C4 protein (His tag)</p>

<p>Purified recombinant KCNMB3 protein (His tag)</p>

<p>Please enquire for more information about Mini gastrin I, human including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cited4 antibody was raised in rabbit using the middle region of Cited4 as the immunogen</p>

<p>Cefmetazole (USP grade powder) chemical reference substance</p>

<p>LY3295668 is a cytostatic agent that has minimal toxicity. It binds to the fatty acid acyl chains in the bacterial membrane, which prevents the bacteria from synthesizing fatty acids and other lipids. LY3295668 also inhibits transcription of bacterial genes involved in growth factor synthesis and blocks DNA-dependent RNA polymerase activity. This agent has been shown to be effective against a number of tumor xenografts, including skin carcinomas and colon adenocarcinomas, with an effective dose range of 10-100 µg/mL. LY3295668 has also been shown to be effective against probiotic bacteria, such as Lactobacillus acidophilus.</p>

<p>Noremopamil is a ligand that binds to the nicotinic acetylcholine receptor, which is found in the brain. It is used as a research tool for studying protein interactions and as an inhibitor of ion channels. Noremopamil has been shown to be an effective activator of the nicotinic acetylcholine receptor and has been used to study its function in the central nervous system. It also has been shown to inhibit potassium channels, which are important for regulating membrane potentials.</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>MBD5 antibody was raised in Rabbit using Human MBD5 as the immunogen</p>

<p>Rabbit polyclonal VATPase G1 antibody (FITC)</p>

<p>TNKS1BP1 antibody was raised using the middle region of TNKS1BP1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE</p>

<p>The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.</p>

<p>Rat monoclonal Integrin beta 7 antibody (biotin)</p>

<p>Mouse monoclonal MAB21L3 antibody</p>

<p>Galloflavin potassium is a peptide that is used as a research tool in the fields of cell biology, pharmacology, and immunology. It has been shown to be an inhibitor of ion channels and receptors, which can lead to a variety of biological effects. Galloflavin potassium has been shown to activate the receptor for acetylcholine, causing the release of neurotransmitters at neuromuscular junctions. Galloflavin potassium also has an affinity for the nicotinic acetylcholine receptor in muscle cells, which may be related to its ability to increase muscle contractions.</p>

<p>Mouse monoclonal SPTAN1 antibody</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>MAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA</p>

<p>UFD1L antibody was raised in rabbit using the middle region of UFD1L as the immunogen</p>

<p>FGF21 protein is a growth factor that plays a crucial role in various biological processes. It acts as a chemokine and has anti-VEGF (vascular endothelial growth factor) properties, making it an important molecule for regulating endothelial growth. FGF21 protein is widely used in the field of Life Sciences, particularly in research related to adipose tissue and metabolic disorders.</p>

<p>MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE</p>

<p>Rabbit polyclonal CDC25A antibody (Thr507)</p>

<p>Mannose binding lectin is a host defense protein which has the ability to recognize a variety of infectious agents. This Mannose Binding Lectin Heavy Tryptic Peptide Standard can be used in protein identification and quantitation studies.</p>

<p>Autocamtide-2-related inhibitory peptide (AIP) is a small peptide. It is an inhibitor of the ion channels in cells and can be used for research purposes. AIP binds to receptor sites on the cell membrane, which are also known as ion channels, and blocks them, preventing ions from passing through the channel. This stops the flow of ions across the membrane and may lead to cell death. AIP has been shown to have a high purity level with a CAS number of 209005-05-0.</p>

<p>The ANTXR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the ANTXR1 protein, which plays a crucial role in collagen metabolism and liver microsome function. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It has been proven to be effective in identifying and quantifying ANTXR1 expression levels in different cell types and tissues.</p>

<p>ZNF326 antibody was raised in rabbit using the N terminal of ZNF326 as the immunogen</p>

<p>Purified recombinant B9D1 protein (His tag)</p>

<p>Rabbit polyclonal TNR antibody</p>

<p>Rabbit polyclonal RGS14 antibody</p>

<p>The TGF alpha antibody is a highly effective monoclonal antibody that is used in Life Sciences research. It has been shown to neutralize the activity of TGF-alpha, a potent chemokine that plays a crucial role in cell growth and development. This antibody binds to TGF-alpha and prevents it from activating its receptors, thereby inhibiting downstream signaling pathways. The TGF alpha antibody is colloidal in nature, allowing for easy and efficient delivery into cells. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Additionally, this antibody has been found to have potential therapeutic applications in diseases involving abnormal TGF-alpha signaling, such as certain types of cancer and neurodegenerative disorders. Its high specificity and affinity make it an invaluable tool for researchers studying the role of TGF-alpha in various biological processes.</p>

<p>Purified recombinant PMF1-BGLAP protein (His tag)</p>

<p>Rabbit polyclonal Cytochrome P450 39A1 antibody</p>

<p>HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV</p>

<p>TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS</p>

<p>The cRel antibody is a monoclonal antibody that specifically targets the nuclear factor cRel. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune responses. The cRel antibody can be used in a variety of assays to study the function and localization of this protein. Additionally, it has been shown to have potential therapeutic applications in the field of life sciences. By targeting cRel, this antibody may help researchers gain valuable insights into diseases such as cancer, autoimmune disorders, and inflammatory conditions. Its high specificity and affinity make it a valuable tool for scientists working in the field of molecular biology and immunology.</p>

<p>6-(3,4-dimethoxyphenyl)-1-ethyl-4-mesitylimino-3-methyl-3,4-dihydro-2(1H)-pyrimidinone is a potent inhibitor of protein interactions. This compound binds to the active site of proteins and blocks the binding of other molecules to these proteins. It has been shown to bind to ion channels, receptors and ligands. 6-(3,4-dimethoxyphenyl)-1-ethyl-4-mesitylimino-3-methyl-3,4-dihydro-2(1H)-pyrimidinone is also an activator of protein interactions. It has been used as a research tool in cell biology and biochemistry.</p>

<p>FSH protein is a multifunctional protein with various characteristics. It acts as a natriuretic factor, promoting the excretion of sodium in the kidneys. Additionally, it functions as a growth factor and chemokine, playing a role in cell proliferation and migration. FSH protein is widely used in research and diagnostic applications as it can be used to generate neutralizing antibodies for various studies. The amino-terminal of FSH protein has been found to have specific binding properties with human serum, making it an essential component in the production of recombinant proteins and antigens. FSH protein can exist in both activated and dimers forms, allowing for different physiological functions depending on its conformation. It has also shown potential therapeutic effects in conditions such as TNF-α-induced inflammation and creatine kinase-related disorders. Researchers often utilize polyclonal and monoclonal antibodies targeting FSH protein to study its expression patterns and biological functions.</p>

<p>Vodobatinib is a small molecule that inhibits the phosphorylation of tyrosine kinases and blocks the downstream cellular signaling pathways. It has been used in research to study protein interactions, activator, and ligand. Vodobatinib is also used as a reagent for antibody production. The compound has high purity and is suitable for use in life science studies.</p>

<p>N-(5-Chloro-2-cyanophenyl)-N'-[2-hydroxy-2-(1-methyl-1H-indol-3-yl)ethyl]ethanediamide is a peptide that inhibits the activation of ion channels. It is also an inhibitor of protein interactions and receptor binding. This compound has been shown to inhibit the activation of ion channels and can be used as a research tool in cell biology, pharmacology, and other life science fields.</p>

<p>Goat anti-human kappa chain (Fab'2) (FITC) was raised in goat using human kappa light chain as the immunogen.</p>

<p>HSP90B1 antibody was raised in Rabbit using Human HSP90B1 as the immunogen</p>

<p>The CD4 antibody is a highly specific monoclonal antibody that targets the CD4 protein, which is expressed on the surface of certain immune cells. This antibody has been extensively studied and has shown various biological effects. It has been found to inhibit syncytia formation, a process in which infected cells fuse together to form giant multinucleated cells. Additionally, the CD4 antibody can block the interaction between CD4 and its ligands, such as the IL-2 receptor, thereby modulating immune responses.</p>

<p>ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG</p>

<p>Rabbit polyclonal TMEM120A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Parainfluenza type 3 antibody was raised in mouse using parainfluenza virus, type 3 as the immunogen.</p>

<p>The Fn14 antibody is a specific antiserum that has chemotactic activity and can target opioid peptides. It is a monoclonal antibody that is widely used in the field of Life Sciences. The Fn14 antibody has been shown to inhibit androgen biosynthesis, making it a valuable tool in research related to hormone regulation. This antibody specifically binds to the antigen binding domain of Fn14, a protein involved in various cellular processes. It has also been used in studies on steroid metabolites and pleomorphic adenoma. Additionally, the Fn14 antibody can be conjugated to a carbon electrode for electrochemical detection methods, such as phenyl phosphate assays.</p>

<p>Purified Polyclonal Kv9.2 antibody</p>

<p>The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.</p>

<p>Mouse serum albumin antibody was raised in goat using mouse serum albumin as the immunogen.</p>

<p>PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS</p>

<p>MF-438 is a novel chemical catalyst, which is synthesized from specialized organic compounds. Functioning as a highly effective facilitator in chemical reactions, it accelerates reaction rates without being consumed in the process. This catalyst operates at a molecular level, optimizing the energy profile of reactions and thereby increasing yield and efficiency.</p>

<p>SMC3 antibody was raised in Rat using Mouse SMC3 and GST fusion protein as the immunogen.</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV</p>

<p>Rabbit polyclonal TMOD4 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Polyclonal Lamin A/C antibody</p>

<p>Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA</p>

<p>Rabbit polyclonal ISG15 antibody (HRP)</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Polyclonal GSTM1 antibody</p>

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>Purified Rabbit polyclonal ELSPBP1 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>rac-Enprostil is a synthetic prostaglandin analog derived from the natural compound prostaglandin E2, produced primarily via synthetic chemical processes. This compound functions by mimicking the action of endogenous prostaglandins on the gastrointestinal mucosa. It enhances the secretion of mucus and bicarbonate, promoting mucosal protection and stability. Additionally, rac-Enprostil inhibits gastric acid secretion, thus providing a protective effect against gastric lesions and ulcers.</p>

<p>N-(3S)-1-Azabicyclo[2.2.2]oct-3-yl-5,6-dihydro-1-naphthalenecarboxamide is a research tool that can be used as an activator or ligand to study protein interactions in cell biology and pharmacology. It has been reported to inhibit the activity of ion channels, such as voltage gated potassium channels and calcium channels. N-(3S)-1-Azabicyclo[2.2.2]oct-3-yl-5,6-dihydro-1-naphthalenecarboxamide also blocks the binding of antibodies to cells and peptides in vitro, which may be due to its ability to inhibit protein synthesis. This chemical is listed on CAS Registry Number 1227162-75-5 and has a purity of &gt;99%.</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT</p>

<p>1-((4-(3-Fluorophenyl)-1-(2-methoxy-4-nitrophenyl)sulfonylpyrrolidin-3-yl)methyl)-4-pyridin-2-ylpiperazine is a drug that belongs to the group of angiotensin receptor antagonists. It was developed for the treatment of pulmonary hypertension and cardiac hypertrophy. 1-(4-(3-Fluorophenyl)-1-(2-methoxy-4-nitrophenyl)sulfonylpyrrolidin-3-yl)methyl)-4 pyridin 2 yl piperazine inhibits the binding of angiotensin II to its receptors in the heart and blood vessels, thereby preventing vasoconstriction and reducing blood pressure. This drug also has been shown to inhibit collagen synthesis in human endometrial cells and lung fibroblasts by blocking transcriptional regulation of type I</p>