Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PIP1 antibody
PIP1 antibody was raised in rabbit using human PIP-1 protein as the immunogen.Purity:Min. 95%Gentamicin-BSA
Gentamicin-BSA is an acidic haptene conjugate that is used in various research applications in the field of Life Sciences. It has been shown to stimulate hepatocyte growth and can be used in the development of monoclonal antibodies. Gentamicin-BSA can also be utilized as an electrode for the detection of CXCR4, a chemokine receptor involved in cell migration and proliferation. Additionally, it has neutralizing properties against certain growth factors and monoclonal antibodies, making it a valuable tool for studying protein-protein interactions. Furthermore, Gentamicin-BSA has been found to inhibit mitochondrial superoxide production, suggesting its potential therapeutic applications in oxidative stress-related disorders.Purity:Min. 95%Galectin 3 protein (His tag)
1-250 amino acids: MGSSHHHHHH SSGLVPRGSH MADNFSLHDA LSGSGNPNPQ GWPGAWGNQP AGAGGYPGAS YPGAYPGQAP PGAYPGQAPP GAYPGAPGAY PGAPAPGVYP GPPSGPGAYP SSGQPSATGA YPATGPYGAP AGPLIVPYNL PLPGGVVPRM LITILGTVKP NANRIALDFQ RGNDVAFHFN PRFNENNRRV IVCNTKLDNN WGREERQSVF PFESGKPFKI QVLVEPDHFK VAVNDAHLLQ YNHRVKKLNE ISKLGISGDI DLTSASYTMIPurity:Min. 95%Chicken anti Mouse IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%Goat anti Human IgG (H + L) (FITC)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%SQLE antibody
SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGENAPA antibody
NAPA antibody was raised in rabbit using the N terminal of NAPA as the immunogenPurity:Min. 95%UEVLD antibody
UEVLD antibody was raised using the N terminal of UEVLD corresponding to a region with amino acids FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPGoat anti Human IgE (ε chain)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%Tau antibody
Tau antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's and Parkinson's. This antibody binds to tau and neutralizes its harmful effects, preventing the formation of toxic tau aggregates. Additionally, Tau antibody has been shown to inhibit the activity of caspase-9, a key enzyme involved in apoptosis. This property makes it a potential therapeutic option for conditions associated with excessive cell death. Furthermore, studies have demonstrated that Tau antibody promotes the growth and differentiation of mesenchymal stem cells, making it a valuable tool in regenerative medicine research. With its high specificity and efficacy, this monoclonal antibody is an essential component in various scientific studies and biomedical applications.Purity:Min. 95%DCP2 antibody
DCP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPCOQ2 antibody
COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAMLPurity:Min. 95%Rabbit anti Dog IgG (HRP)
Rabbit anti-dog IgG (HRP) was raised in rabbit using canine IgG F(c) fragment as the immunogen.Purity:Min. 95%P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHSeptin 9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT9 antibody, catalog no. 70R-3525
Purity:Min. 95%Goat anti Human IgG
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%EFHA2 antibody
EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
DDR1 antibody
DDR1 antibody was raised in Mouse using a purified recombinant fragment of DDR1(aa602-681) expressed in E. coli as the immunogen.
EDN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EDN3 antibody, catalog no. 70R-10261Purity:Min. 95%Ppp3cb antibody
Ppp3cb antibody was raised in rabbit using the C terminal of Ppp3cb as the immunogenPurity:Min. 95%SNAPAP protein (His tag)
1-136 amino acids: MGSSHHHHHH SSGLVPRGSH MAGAGSAAVS GAGTPVAGPT GRDLFAEGLL EFLRPAVQQL DSHVHAVRES QVELREQIDN LATELCRINE DQKVALDLDP YVKKLLNARR RVVLVNNILQ NAQERLRRLN HSVAKETARR RAMLDSGIYP PGSPGKPurity:Min. 95%RP11-298P3.3 antibody
RP11-298P3.3 antibody was raised using the N terminal of RP11-298P3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
MRC2 antibody
The MRC2 antibody is a highly specific monoclonal antibody that targets the MRC2 protein. This protein is involved in various cellular processes, including insulin signaling, collagen metabolism, and cell adhesion. The MRC2 antibody has been extensively studied and has shown great potential in research and diagnostic applications.PSG6 antibody
PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVBovine β Lactoglobulin antibody
Affinity purified Rabbit polyclonal Bovine beta Lactoglobulin antibodyPurity:Min. 95%TASP1 antibody
TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAINR1H2 antibody
NR1H2 antibody was raised using the middle region of NR1H2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAICAND2 antibody
CAND2 antibody was raised in rabbit using the N terminal of CAND2 as the immunogenPurity:Min. 95%IKBA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. With its potent action against tuberculosis, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable weapon in the fight against this infectious disease.OR2AT4 antibody
The OR2AT4 antibody is a highly specialized polyclonal and monoclonal antibody that has been developed to target the alpha-fetoprotein (AFP) molecule. It possesses neutralizing properties against AFP, which plays a crucial role in various biological processes. This antibody has been extensively studied for its potential applications in the field of Life Sciences, particularly in the area of mesenchymal stem cell research.TTC12 antibody
TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLKWNT5B antibody
WNT5B antibody was raised using the C terminal of WNT5B corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
MAGEC2 antibody
MAGEC2 antibody was raised in rabbit using the N terminal of MAGEC2 as the immunogenPurity:Min. 95%Goat anti Chicken IgG (H + L) (FITC)
This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.Purity:Min. 95%GLYATL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLYATL2 antibody, catalog no. 70R-2525
Purity:Min. 95%GluR1 antibody
The GluR1 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the GluR1 protein, which plays a crucial role in excitatory synaptic transmission in the central nervous system. This antibody has been extensively characterized and validated for its specificity and sensitivity.Purity:Min. 95%STAT5A antibody
The STAT5A antibody is a highly specialized antibody that has neutralizing properties against endothelial growth factors. It is commonly used in the field of Life Sciences for its antiangiogenic effects. This antibody specifically targets and inhibits the growth factor responsible for promoting angiogenesis, which is the formation of new blood vessels.Purity:Min. 95%PLSCR3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLSCR3 antibody, catalog no. 70R-1990Purity:Min. 95%CD5 antibody (Spectral Red)
CD5 antibody (Spectral Red) was raised in rat using CD5/Lyt-1 as the immunogen.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.SEMA4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA4B antibody, catalog no. 70R-7129Purity:Min. 95%ApoBEC2 antibody
ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILGoat anti Rabbit IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%SF1 antibody
SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWWFasL protein
Region of FasL protein corresponding to amino acids HHHHHHHHPS PPPEKKELRK VAHLTGKSNS RSMPLEWEDT YGIVLLSGVK YKKGGLVINE TGLYFVYSKV YFRGQSCNNL PLSHKVYMRN SKYPQDLVMM EGKMMSYCTT GQMWARSSYL GAVFNLTSAD HLYVNVSELS LVNFEESQTF FGLYKL.Purity:Min. 95%Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.GART Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GART antibody, catalog no. 70R-4053
Purity:Min. 95%PNOC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNOC antibody, catalog no. 70R-6212Purity:Min. 95%ODF2L antibody
ODF2L antibody was raised using the N terminal of ODF2L corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSHENO2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENO2 antibody, catalog no. 70R-10176Purity:Min. 95%KHDRBS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KHDRBS1 antibody, catalog no. 20R-1132
Purity:Min. 95%HAVCR1 antibody
HAVCR1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available both as a monoclonal antibody and polyclonal antibodies. This antibody specifically targets HAVCR1, also known as Kidney Injury Molecule 1 (KIM-1), which is a cation channel involved in various biological processes.
PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMPCSK2 antibody
PCSK2 antibody was raised in rabbit using the middle region of PCSK2 as the immunogenPurity:Min. 95%Goat anti Human kappa chain (HRP)
This antibody reacts with heavy (gamma) chains on human IgG and light chains on all human immunoglobulins.Purity:Min. 95%SLC10A3 antibody
SLC10A3 antibody was raised in rabbit using the middle region of SLC10A3 as the immunogenPurity:Min. 95%EVI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EVI1 antibody, catalog no. 70R-4771
Purity:Min. 95%PARK7 antibody
The PARK7 antibody is a highly effective tool for researchers in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and inhibits the function of PARK7, a growth factor involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and potency.Claudin 2 antibody
The Claudin 2 antibody is a monoclonal antibody that specifically targets the Claudin 2 protein. This protein is involved in the regulation of tight junctions between cells, which play a crucial role in maintaining the integrity of epithelial barriers. The Claudin 2 antibody has been shown to inhibit the activity of this protein, leading to increased barrier function and prevention of paracellular permeability.FAM126A antibody
FAM126A antibody was raised in rabbit using the C terminal of FAM126A as the immunogenCDK6 antibody
The CDK6 antibody is a highly specialized antibody that targets the cyclin-dependent kinase 6 (CDK6) protein. It is commonly used in research laboratories for various applications, including immunoblotting, immunoprecipitation, and immunofluorescence. This antibody specifically recognizes and binds to CDK6, which plays a crucial role in cell cycle regulation and cell proliferation.Purity:Min. 95%UNC84B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UNC84B antibody, catalog no. 70R-6991Purity:Min. 95%
