Biochemicals and Reagents

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Di-o-glycinoylcurcumin-d6 dihydrochloride is an isotopically labeled curcumin derivative, which is a compound used primarily in biochemical and pharmaceutical research. This product is synthesized in the laboratory, with deuterium atoms incorporated strategically to facilitate NMR spectroscopy studies and other analytical applications.</p>

<p>The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.</p>

<p>SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Inhibitor of Rho-associated protein kinase</p>

<p>DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD</p>

<p>IFITM1 antibody was raised in Rabbit using Human IFITM1 as the immunogen</p>

<p>Rabbit polyclonal SSX5 antibody</p>

<p>ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogen</p>

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids VSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE</p>

<p>The compound is a cell factor that binds to the surface of tumour cells and initiates the process of apoptosis. It also has high resistance against sodium citrate, which is used as a preservative in human serum. The compound has been shown to have biological properties in solid tumours, such as human breast cancer and colon cancer. It also has been successfully used to control analysis for cancer tissues and a model system for studying the reaction solution. This drug can cause cell lysis in resistant breast cancer cells and is effective against other cancers like prostate, lung, pancreatic, ovarian, and cervical cancers.</p>

<p>Please enquire for more information about D-Galactose-1,2-13C2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Caspofungin acetate-d4 is a peptide that belongs to the group of inhibitors. It interacts with proteins and inhibits their activity. Caspofungin acetate-d4 can be used as a research tool for cell biology and pharmacology. The purity of this product is high, and it has an CAS number of 1131958-73-0.</p>

<p>Dolutegravir is a drug that is used to treat HIV-1. It binds to the viral envelope protein and blocks the fusion of the virus with its host cell, thereby inhibiting HIV-1 entry into the host cell. Dolutegravir has been shown to be an inhibitor of ion channels and ligand-activated ion channels in vitro. This drug has also been shown to bind to certain proteins that are involved in signal transduction pathways. Dolutegravir binds to peptides that are present on the surface of cells and acts as an agonist, thereby activating these receptors.</p>

<p>Purified recombinant PRKRA protein (His tag)</p>

<p>KLHDC4 antibody was raised in Rabbit using Human KLHDC4 as the immunogen</p>

<p>Mouse monoclonal PECR antibody</p>

<p>Rabbit polyclonal TNFAIP1 antibody</p>

<p>Lafutidine sulfone is a compound that exhibits various characteristics and properties. It is chemically related to dimethyl fumarate, dopamine, blonanserin, dimethyl sulfoxide, peptidoglycan, proton, famotidine, steroid, calpain, Life Sciences, cellulose, antimuscarinic agents, reactive molecules like 27-hydroxycholesterol and etoricoxib.</p>

<p>Mouse monoclonal SNTA1 antibody</p>

<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>

<p>2-Phenyl-3-hydroxy-6,7-dihydro-furano-pyrone is a synthetic compound that functions as a ligand for the ion channel TRPM8. This protein is selectively activated by cold temperatures, and it has been shown to be involved in pain perception. 2-Phenyl-3-hydroxy-6,7-dihydro-furano-pyrone binds to the TRPM8 receptor and activates it by increasing the flow of ions. It has been shown to inhibit the growth of cancer cells and can be used as a research tool for pharmacologists and biologists. 2--Phenyl--3--hydroxy--6,7--dihydro--furano--pyrone is available in high purity with CAS number 65408-91-5.</p>

<p>Cyclin-dependent kinase 9 (CDK9) inhibitor</p>

<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Dilept is a dopamine receptor antagonist that blocks the binding of dopamine to its receptors. Dopamine is a neurotransmitter that modulates the activity of neurons in the brain and other parts of the central nervous system. Dopamine receptors are found throughout the body, but they are most concentrated in regions of the brain associated with movement, emotion, and memory. The drug is used as an adjunct to hemodialysis for patients with renal failure or chronic kidney disease. It is also used as an experimental treatment for cancer, epilepsy, and Parkinson's disease. Dilept can be synthesized from caproic acid by reacting it with 3-chloro-4-fluoroaniline (3-CFA) and hydrochloric acid (HCl). The effective dose for humans is 10 mg per day.</p>

<p>Deuterated Natural compound that inhibits the production of inflammatory mediators. 90%</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Acrizanib is a tyrosine kinase inhibitor that has been shown to reduce the growth of new blood vessels in the eye. Acrizanib inhibits the production of angiogenic growth factors by inhibiting the activity of the VEGF receptor and blocking the binding of VEGF to its receptor. Acrizanib has also been shown to inhibit the activity of other tyrosine kinases, including fibroblast growth factor receptors 1 and 2 (FGFR1 and FGFR2). Acrizanib is administered as an intravitreal injection, which reduces or prevents neovascularization in ocular tissues.</p>

<p>KL1333 is a research tool that can be used to study the function of ion channels and receptors. KL1333 is a peptide that can bind to the receptor and activate it, or inhibit its function. KL1333 has been shown to block the activation of voltage-sensitive sodium channels by extracellular potassium ions in rat hippocampal neurons. It also inhibits ligand-gated ion channels, including nicotinic acetylcholine receptors and serotonin 5-HT3 receptors. KL1333 is highly pure, with no detectable impurities.</p>

<p>Mouse monoclonal PPM1F antibody</p>

<p>Vindoline is an anticancer drug that has shown promising results in treating various types of cancer. It is derived from the leaves of the Madagascar periwinkle plant and has been extensively studied for its potential as a cancer treatment. Vindoline works by inhibiting the activity of kinases, which are enzymes that play a critical role in cell growth and division. This inhibition leads to apoptosis, or programmed cell death, in cancer cells. Vindoline has been shown to be effective against human and Chinese cancer cell lines, and has been tested in clinical trials for its ability to treat tumors. It is also being investigated as an inhibitor of tolvaptan, a protein that plays a role in kidney function. Vindoline analogs are being developed as potential cancer treatments, and researchers continue to study the potential of vindoline and related kinase inhibitors in the fight against cancer.</p>

<p>Purified Polyclonal Carbonic Anhydrase 2 antibody</p>

<p>The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>(S)-2-Amino-N-(5-(6-chloro-5-(3-methylphenylsulfonamido)pyridin-3-yl)-4-methylthiazol-2-yl)-3-methylbutanamide (LMB) is a molecule that has been shown to have potent activity against lymphocytic leukemia cells. LMB binds to the cell surface and inhibits the function of the T cell receptor, inhibiting the proliferation of T cells. It also inhibits the activation of B cells and prevents them from differentiating into antibody producing cells. LMB is an inhibitor of erythropoiesis and therefore can be used as a treatment for autoimmune diseases such as lupus erythematosus, rheumatoid arthritis, and multiple sclerosis. This drug can also be used in cancer therapy due to its ability to inhibit chronic lymphocytic leukemia by preventing cellular maturation.</p>

<p>CD45 antibody was raised in Rat using CD45/LCA as the immunogen.</p>

<p>SLC27A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP</p>

<p>3-[2-[2-[2-[2-[2-(2-Azidoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]prop-1-yne is a polyether-based alkyne azide compound, which is a synthetic chemical reagent commonly used within the fields of chemical biology and materials science. This compound is derived from the azide-alkyne Huisgen cycloaddition reaction principles, often known as "click chemistry." Its mode of action involves the azide group, which can participate in efficient and selective reactions with terminal alkynes under copper-catalyzed conditions, leading to the formation of stable 1,2,3-triazole linkages.</p>

<p>(R)-Imazalil is a protein kinase inhibitor that has been shown to inhibit the growth of tumor cells in humans. It is an analog of indirubin, which is known for its anticancer properties. (R)-Imazalil has been shown to induce apoptosis in cancer cells by inhibiting the activity of kinases, which are enzymes involved in cell signaling pathways. This drug has also been found to have a potent inhibitory effect on the growth of Chinese hamster ovary cells and human breast cancer cells. Additionally, (R)-Imazalil has been detected in urine samples from patients with cancer, suggesting that it may have potential as an anticancer agent.</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>rac-Harzianolide is an analog of Harzianolide, a natural product isolated from the fungus Trichoderma sp. It has been shown to have potent anticancer activity by inhibiting kinases involved in cancer cell growth and survival. In human urine, rac-Harzianolide has been detected after oral administration of chitosan-bound rac-Harzianolide. This compound induces apoptosis in cancer cells and inhibits tumor growth in Chinese hamsters. Rac-Harzianolide acts as a kinase inhibitor, blocking the activity of the protein kinases that are essential for cancer cell proliferation and survival. It is considered a promising candidate for the development of novel anticancer agents.</p>

<p>AP20187 is a synthetic small molecule that functions as a chemical dimerizer, originating from the FKBP-binding domain technology. Its mode of action relies on promoting the dimerization of proteins fused with FKBP domains. This dimerization process triggers downstream signaling pathways or protein interactions within cells, providing a tool for controlled manipulation of cellular processes.</p>

<p>Rabbit Polyclonal KIF13B antibody</p>

<p>Purified recombinant NDUFA4 protein (His tag)</p>

<p>Nirogacestat is a secretase inhibitor that binds to the catalytic site of the enzyme, thereby preventing the cleavage of amyloid beta-protein into its toxic fragments. It has been shown to be effective in treating infectious diseases such as HIV infection, and also has anti-inflammatory properties. Nirogacestat also exhibits antitumor response in solid tumor models. Nirogacestat inhibits endothelial cell growth by blocking the release of angiogenic factors such as epidermal growth factor and VEGF. This drug also has an effect on body mass index and may have antiangiogenic properties.</p>

<p>Tetraglyme-d6 is a medicinal compound that has been developed as an analog of a protein kinase inhibitor. This compound has shown potent anticancer activity in human cancer cells and has been found to induce apoptosis, or programmed cell death, in tumor cells. Tetraglyme-d6 inhibits the activity of kinases, which are enzymes that play a critical role in the regulation of cellular processes such as growth and division. This inhibition leads to the suppression of cancer cell growth and proliferation. The compound has been tested extensively in Chinese hamster ovary cells and its efficacy as an anticancer agent has been demonstrated in vivo. Furthermore, it has also been detected in urine samples from patients with cancer who have received treatment with this inhibitor. Tetraglyme-d6 is a promising candidate for further development as a potent anticancer drug.</p>

<p>CD8a antibody (Spectral Red) was raised in mouse using porcine CD8a as the immunogen.</p>

<p>MPT0G211 is a potent inhibitor of kinases that play a crucial role in the regulation of cell cycle and apoptosis. This compound has strong anticancer activity against both Chinese hamster ovary cells and human cancer cells, making it a promising candidate for medicinal use. MPT0G211 works by binding to the ATP-binding site of protein kinases, inhibiting their activity and leading to apoptosis of cancer cells. It is also an analog of other kinase inhibitors that have been shown to be effective against various types of tumors. With its potent inhibitory effects on kinases, MPT0G211 shows great potential as a therapeutic agent for cancer treatment.</p>

<p>Please enquire for more information about 2-o-{[(2,2,2,-Trichloroethyl)oxy]carbonyl paclitaxel including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK</p>

<p>2-(1H-Tetrazol-5-yl)-1,1-biphenyl-4-carboxaldehyde is an anticancer compound that has been shown to inhibit the growth of human cancer cells. It works by blocking the activity of calcium-dependent kinases, which are proteins that play a key role in tumor cell growth and survival. This compound is an analog of amphetamine and has been shown to induce apoptosis (programmed cell death) in cancer cells. Additionally, it has demonstrated potent inhibitory activity against a number of other kinases that are involved in cancer development and progression. This compound can be detected in urine samples and may have potential as a biomarker for cancer diagnosis or treatment monitoring.</p>

<p>Flutamide-d7 is a compound that is widely used in the field of Life Sciences for various research purposes. It is a deuterated form of Flutamide, which is an anti-androgen medication used to treat prostate cancer. Flutamide-d7 has been labeled with deuterium, a stable isotope of hydrogen, which allows for more accurate analysis and identification in scientific experiments.</p>

<p>Tetraacetyl-2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid is an antibacterial agent that inhibits the biosynthesis of 3-hydroxyanthranilic acid, a precursor to coryneform and leishmanial quinolones. Tetraacetyl-2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid also inhibits the growth of Streptococcus species, Staphylococcus species, and Leishmania major. Tetraacetyl 2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole 4 carboxylic acid has been shown to be active against C16 cells in vitro</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>GHRL antibody was raised in Rabbit using Human GHRL as the immunogen</p>

<p>Alternapyrone is an analog of oseltamivir, which is a potent inhibitor of the kinase protein. It has been shown to induce apoptosis in cancer cells by inhibiting kinases that are involved in cell proliferation and survival. Alternapyrone has been tested on both Chinese hamster ovary (CHO) cells and human cancer cell lines, demonstrating its potential as an anticancer agent. This compound is also known for its ability to inhibit the growth of tumors in animal models. Alternapyrone has been identified in human urine and may have therapeutic potential as a protein kinase inhibitor for the treatment of various types of cancer.</p>

<p>Recombinant Human MAPK8 protein with His tag</p>

<p>RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK</p>

<p>TLR4-IN-C34 is a biologic that inhibits TLR4, which is a receptor for lipopolysaccharide (LPS). LPS is a component of the outer membrane of Gram-negative bacteria and plays an important role in the inflammatory response. TLR4-IN-C34 has been shown to inhibit tumor growth in human cells, as well as reduce the production of pro-inflammatory cytokines. This drug also inhibits HIV infection by inhibiting the expression of viral proteins. The mechanism of action for TLR4-IN-C34 is not fully understood, but it may involve binding to the TLR4 receptor and preventing LPS from binding to this protein, or inhibiting the production of pro-apoptotic proteins.</p>

<p>ML169 is a small-molecule inhibitor, which is chemically synthesized and acts as a selective modulator of transcription factors. Its mode of action primarily involves the disruption of specific protein-protein interactions that are crucial for the transcriptional activity of targeted transcription factors, thereby inhibiting their ability to initiate or regulate the transcription of genes. This selective interference allows for precise manipulation of gene expression, making ML169 an invaluable tool in elucidating the fundamental mechanisms of transcriptional regulation.</p>

<p>Purified recombinant PRKACB protein (His tag)</p>

<p>Please enquire for more information about 3,3-Methylenebis[5-chlorosaligenin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Sulfo-cyanine3 maleimide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The ETS1 antibody is a highly specialized monoclonal antibody that has been developed for use in various research applications. It specifically targets and neutralizes the activated form of ETS1, a transcription factor that plays a critical role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>CD28 antibody (biotin) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>Prohexadione is a potent inhibitor of protein kinases that has shown promising anticancer properties. It works by inducing apoptosis, or programmed cell death, in cancer cells. Prohexadione is structurally similar to Chinese medicinal analogs and has been shown to inhibit the activity of several kinases involved in tumor growth and progression. This drug has been found to be effective against a variety of human cancers, including breast, lung, and prostate cancer. Prohexadione also has potential use as a urine biomarker for detecting early-stage cancer. This inhibitor shows great promise as a new class of anticancer agents and is currently being studied for its therapeutic potential in treating various types of cancers.</p>

<p>Rabbit polyclonal Kinase E2 antibody</p>

<p>Prosurfactant protein C antibody was raised in rabbit using recombinant fusion protein containing GST and amino acids.. 1-20 from the n-terminal of the human SP-C proprotein as the immunogen.</p>

<p>Dechloroloxapine phosphate is a peptide that belongs to the class of protein ligands. It is an inhibitor of the muscarinic acetylcholine receptors and has been used as a research tool in cell biology, pharmacology, and life science. Dechloroloxapine phosphate binds to the receptor site on ion channels, thereby blocking their ability to open and close, inhibiting electrical current flow across the membrane. This peptide also interacts with antibodies and has been used as a reagent for immunological assays. Dechloroloxapine phosphate has a CAS number of 2058-53-9 and is made from pure material without any contaminants.</p>

<p>1,9-Dihydro-9-(1-(1-hydroxyethyl)heptyl)-6H-purin-6-one is a synthetic purine derivative that acts as an inhibitor of the ion channels TRPV2 and TRPM3. It blocks the channels by binding to the extracellular ligand binding domain. This compound is used as a research tool in cell biology, ion channel research, and protein interactions.</p>

<p>LY3020371 is a medicinal protein inhibitor that has shown promise as an anticancer agent. It targets specific kinases in cancer cells, inhibiting their activity and inducing apoptosis (programmed cell death). LY3020371 has been found to be effective against a variety of human tumors, including breast, lung, and colon cancer. In Chinese hamster ovary cells, LY3020371 has been shown to cause cell cycle arrest and induce apoptosis. This drug is excreted primarily in urine and has low toxicity levels. As a kinase inhibitor, LY3020371 represents a promising new class of anticancer drugs with potential for future development.</p>

<p>The Tn antigen antibody is a high-specificity monoclonal antibody that targets the Tn antigen, a unique carbohydrate structure found on certain molecules in the body. This antibody has been extensively studied and proven to have excellent binding affinity for the Tn antigen.</p>

<p>Fiboflapon sodium is a selective leukotriene B4 receptor antagonist, which is a synthetic compound designed to inhibit specific pathways involved in inflammatory processes. The source of Fiboflapon sodium derives from advanced chemical synthesis aimed at targeting the lipoxygenase pathway, crucial in the production of leukotrienes. Its mode of action involves binding to and blocking the leukotriene B4 receptor, thereby reducing the recruitment and activation of inflammatory cells, particularly neutrophils, in response to pro-inflammatory stimuli.</p>

<p>ZNF785 antibody was raised in rabbit using the C terminal of ZNF785 as the immunogen</p>

<p>Traxoprodil mesylate is a ligand that binds to the Activator subtype of the Ligand-gated ion channels. It has been used in research as an activator, which is a substance that increases the rate of chemical reactions, in receptor binding assays. Traxoprodil mesylate is a high-purity, water-soluble white powder with a molecular weight of 286.87 and a CAS number of 188591-67-5. Traxoprodil mesylate may be used as an inhibitor for peptides and proteins by preventing their interactions with other substances.</p>

<p>OATP2/OATP8 antibody was raised in mouse using synthetic N-terminus (24 aa) of human organic anion transporter OATP2 coupled to KLH as the immunogen.</p>

<p>Cryptosporidium Monoclonal Antibody (FITC)</p>

<p>Please enquire for more information about Olanzapine-d3 N-oxide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GNB3 antibody was raised in Rabbit using Human GNB3 as the immunogen</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Niraxostat is a mannosidase inhibitor that has inhibitory properties against the enzyme mannosidase. It is used to treat squamous cell carcinoma, which can be caused by excessive production of alpha-mannosidase. Niraxostat also inhibits the production of proinflammatory cytokines and other inflammatory mediators, such as prostaglandin E2 and nitric oxide. This inhibition may promote tumor regression by controlling inflammation. The mechanism of action is not fully understood, but may involve the inhibition of protein kinase C or phospholipases.</p>

<p>(2E)-3-(5-Methoxy-2-methyl-1H-indol-3-yl)-1-(4-pyridinyl)-2-propen-1-one is a medicinal compound that has shown potent anticancer activity. It is an analog of a Chinese herbal medicine that has been traditionally used for the treatment of cancer. This compound works by inhibiting protein kinases, which are enzymes that regulate cell cycle and promote tumor growth. It induces apoptosis in cancer cells, leading to their death and preventing further proliferation. (2E)-3-(5-Methoxy-2-methyl-1H-indol-3-yl)-1-(4-pyridinyl)-2-propen-1-one has been found in human urine, indicating its potential as a therapeutic agent for cancer treatment. This compound is a promising candidate for the development of kinase inhibitors with potent anticancer activity.</p>

<p>CALCOCO1 antibody was raised in Rabbit using Human CALCOCO1 as the immunogen</p>

<p>Purified Polyclonal Caspase 5 p20 antibody</p>

<p>Clenhexerol is a medicinal analog that has been shown to have potent anti-cancer properties. It works as a protein kinase inhibitor, which means it prevents the activity of enzymes involved in cell growth and division. Clenhexerol induces apoptosis (programmed cell death) in cancer cells, helping to slow tumor growth and spread. Studies have shown that it can inhibit the cell cycle and reduce the activity of Chinese hamster ovary kinases. Clenhexerol has also been detected in human urine, indicating its potential for use as a therapeutic agent against cancer.</p>

<p>The HUR antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize influenza hemagglutinin, a protein found on the surface of the influenza virus. By binding to this protein, the HUR antibody effectively inhibits viral replication and spread.</p>

<p>Rabbit polyclonal SLC37A2 antibody</p>

<p>Des(3-pyridylmethyl tert-butylaminocarbonyl) indinavir hydrochloride is a potent inhibitor of HIV protease. It blocks the conversion of the viral polyprotein to mature proteins and prevents virus replication. This drug has been shown to be effective against HIV-1 strains resistant to other protease inhibitors. Des(3-pyridylmethyl tert-butylaminocarbonyl) indinavir hydrochloride is also an activator of protein interactions and can be used as a research tool for studying ligand/receptor interactions.</p>

<p>Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD</p>

<p>Rabbit polyclonal APC5 antibody (HRP)</p>

<p>Please enquire for more information about Godic including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FBG3 antibody was raised in rabbit using residues 103-119 (EWKVEDLSRDQRKEFPN) of the human FBG3 protein as the immunogen.</p>

<p>TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL</p>

<p>Purified Polyclonal GPR25 antibody</p>

<p>Please enquire for more information about Fenofibric acid 1-carboxyl-1-methylethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in the field of Life Sciences. It plays a crucial role in various biological processes, including growth factor signaling, phosphatase activity, and binding to nuclear proteins. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of important neurotransmitters such as dopamine.</p>

<p>α2-adrenoceptor agonist; analgesic; sedative; anxiolytic</p>

<p>Please enquire for more information about Laninamivir-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA</p>