Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DAZ3 antibody
DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF
SOD2 antibody
The SOD2 antibody is a monoclonal antibody that specifically binds to the superoxide dismutase 2 (SOD2) protein. This protein plays a crucial role in protecting cells against oxidative stress by scavenging harmful superoxide radicals. The SOD2 antibody can be used in various applications, including receptor binding studies, virus surface antigen detection, and as a research tool in Life Sciences. It is highly specific and has been extensively validated for its performance.GNA15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNA15 antibody, catalog no. 70R-5809Purity:Min. 95%TMED8 antibody
TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIBBS2 antibody
BBS2 antibody was raised in rabbit using the middle region of BBS2 as the immunogenPurity:Min. 95%SENP5 antibody
SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRβ Catenin antibody
The beta Catenin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the beta-catenin protein, which plays a crucial role in cell adhesion and signaling pathways. This antibody has been extensively tested and proven to have high specificity and sensitivity for detecting beta-catenin in various applications.IGF-1R antibody
The IGF-1R antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor 1 receptor (IGF-1R). This receptor plays a crucial role in cell growth, proliferation, and survival. By binding to the IGF-1R, this antibody effectively blocks the interaction between IGF-1 and its receptor, inhibiting downstream signaling pathways.Purity:Min. 95%SLITRK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLITRK1 antibody, catalog no. 70R-7285Purity:Min. 95%CMV antibody (HRP)
CMV antibody (HRP) was raised in goat using purified virions of strain AD169 as the immunogen.TAF9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAF9 antibody, catalog no. 70R-8040Purity:Min. 95%OIP5 antibody
The OIP5 antibody is a highly specialized antibody that plays a crucial role in the immune response. It is an interferon-induced protein that is involved in various cellular processes, including cell growth and differentiation. The OIP5 antibody specifically targets enteroendocrine cells and has been shown to regulate their function.
SYT3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SYT3 antibody, catalog no. 70R-6596Purity:Min. 95%NSUN6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN6 antibody, catalog no. 70R-4985Purity:Min. 95%CBLL1 antibody
CBLL1 antibody was raised in rabbit using the C terminal of CBLL1 as the immunogenPurity:Min. 95%ABAT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABAT antibody, catalog no. 70R-2214SNAI1 antibody
The SNAI1 antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits BACE1, an enzyme involved in the production of amyloid-beta peptides. These peptides are known to play a crucial role in the development of Alzheimer's disease. The SNAI1 antibody has been extensively studied and has shown promising results in neutralizing BACE1 activity, thus potentially slowing down the progression of the disease. Additionally, this antibody has low density dimers, which allows for enhanced penetration into tissues and improved therapeutic efficacy. Its unique glycosylation pattern also contributes to its stability and cytotoxicity against cancer cells. With its potential as a diagnostic tool and medicament, the SNAI1 antibody holds great promise in advancing our understanding and treatment options for various diseases related to BACE1 activity and growth factors.VPS4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4B antibody, catalog no. 70R-10350Purity:Min. 95%Goat anti Guinea Pig IgG (H + L) (biotin)
This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.Purity:Min. 95%Rabbit anti Goat IgG (Alk Phos)
Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%KCNQ1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNQ1 antibody, catalog no. 70R-1537Purity:Min. 95%Harbi1 antibody
Harbi1 antibody was raised in rabbit using the N terminal of Harbi1 as the immunogenPurity:Min. 95%ALAD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALAD antibody, catalog no. 70R-8516Purity:Min. 95%PBEF1 antibody
PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHVEGF121 protein (His tag)
207-327 amino acids: MGSSHHHHHH SSGLVPRGSH MAPMAEGGGQ NHHEVVKFMD VYQRSYCHPI ETLVDIFQEY PDEIEYIFKP SCVPLMRCGG CCNDEGLECV PTEESNITMQ IMRIKPHQGQ HIGEMSFLQH NKCECRPKKD RARQEKCDKP RRPurity:Min. 95%BCL6B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BCL6B antibody, catalog no. 70R-8459Purity:Min. 95%FasL antibody
FasL antibody was raised in goat using highly pure recombinant human FasL/Apo1L as the immunogen.Purity:Min. 95%SUSD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SUSD4 antibody, catalog no. 70R-6885Purity:Min. 95%RORA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RORA antibody, catalog no. 70R-1937Purity:Min. 95%14-3-3 epsilon antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been proven through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.IQCB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IQCB1 antibody, catalog no. 70R-9889Purity:Min. 95%ZNF385B antibody
ZNF385B antibody was raised in rabbit using the C terminal of ZNF385B as the immunogenPurity:Min. 95%SMC1 antibody
The SMC1 antibody is a polyclonal antibody that specifically targets the glycoprotein SMC1. This antibody is widely used in life sciences research to study various cellular processes and pathways. It has been shown to have binding affinity towards erythropoietin, mitogen-activated protein (MAP) kinases, collagen, fibronectin, and multidrug resistance proteins. Additionally, the SMC1 antibody can detect autoantibodies, interleukin-6, p38 MAP kinase, monoclonal antibodies, chemokines, and steroids. Its versatility and specificity make it an essential tool for researchers in various fields of study.
Purity:Min. 95%PUM2 antibody
PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPADKLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGD
C18orf25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C18orf25 antibody, catalog no. 70R-4005Purity:Min. 95%NAP2 antibody
NAP2 antibody was raised in rabbit using highly pure recombinant hNAP-2 as the immunogen.Purity:Min. 95%SPRY2 antibody
SPRY2 antibody was raised in rabbit using the N terminal of SPRY2 as the immunogenPurity:Min. 95%SERPINB13 antibody
The SERPINB13 antibody is a powerful tool in the field of life sciences. This monoclonal antibody has shown great potential as an antiviral agent, particularly against brain natriuretic peptide (BNP). It works by neutralizing the activity of BNP, which is involved in various physiological processes. The SERPINB13 antibody has been extensively tested and proven to be highly effective in inhibiting the activation of fibrinogen, a key player in blood clotting. Its specificity and high affinity make it an ideal choice for research purposes. With its exceptional properties, this antibody holds great promise for advancing our understanding of various biological pathways and developing novel therapeutic interventions.FANCL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FANCL antibody, catalog no. 70R-3410Purity:Min. 95%HSV2 antibody (FITC)
HSV2 antibody (FITC) was raised in sheep using HSV type 2, strain G as the immunogen.
FAM78A antibody
FAM78A antibody was raised using the N terminal of FAM78A corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVTIPARP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIPARP antibody, catalog no. 70R-3180Purity:Min. 95%EIF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF6 antibody, catalog no. 70R-10307Purity:Min. 95%Rabbit anti Human IgG (HRP)
Rabbit anti-human IgG (HRP) was raised in rabbit using human IgG gamma chain as the immunogen.Purity:Min. 95%ZNF579 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF579 antibody, catalog no. 70R-8138Purity:Min. 95%BTF3 antibody
BTF3 antibody was raised in rabbit using the middle region of BTF3 as the immunogenPurity:Min. 95%SULT1A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1A1 antibody, catalog no. 70R-2618Purity:Min. 95%c-Kit antibody
The c-Kit antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Kit protein, also known as CD117. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival.Purity:Min. 95%SEC14L4 antibody
SEC14L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQPC antibody
The PC antibody is a growth factor that functions as a monoclonal antibody. It binds to specific binding proteins and is commonly used in the field of immunology. This antibody plays a crucial role in the immune response by targeting antigens and promoting the destruction of harmful cells. The PC antibody has been extensively studied and has shown great potential in various applications, including diagnostics and therapeutics. It has also been found to be effective against autoantibodies and cell antibodies, making it an essential tool for researchers in the field. With its high specificity and ability to recognize phosphorylcholine, this antibody offers a valuable resource for studying lipid peroxidation and cytotoxicity. Whether you're conducting research or developing new treatments, the PC antibody is an indispensable tool that can provide accurate and reliable results. Choose polyclonal or monoclonal antibodies based on your specific needs and take advantage of their exceptional performance. Trust in the power of the PC antibody to enhance your experiments and advance your scientific discoveries.KHDRBS3 antibody
KHDRBS3 antibody was raised using the N terminal of KHDRBS3 corresponding to a region with amino acids MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVIDDX5 antibody
DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYVEGFB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VEGFB antibody, catalog no. 70R-9647Purity:Min. 95%Rabbit anti Mouse IgG1 (biotin)
Rabbit anti-mouse IgG1 (biotin) was raised in rabbit using murine IgG1 heavy chain as the immunogen.Purity:Min. 95%EIF2S1 antibody
EIF2S1 antibody was raised using the N terminal of EIF2S1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
ArpT1 antibody
Arp-T1 antibody was raised in Guinea Pig using synthetic N-terminal domain of human Arp-T1 protein coupled to KLH as the immunogen.
Purity:Min. 95%CDC2 antibody
The CDC2 antibody is a highly specialized antibody that targets the activated form of CDC2, a protein involved in cell division and growth. This antibody is widely used in research and clinical applications to study the role of CDC2 in various biological processes. It can be used as an inhibitor to block the activity of CDC2, allowing researchers to investigate its function and potential therapeutic applications. The CDC2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. These antibodies have been extensively tested and validated in Life Sciences research, ensuring their reliability and accuracy. Additionally, the CDC2 antibody has neutralizing capabilities, making it an ideal tool for studying the effects of CDC2 on adipose tissue growth and other cellular processes. Whether you are conducting basic research or developing new therapies, the CDC2 antibody is an essential tool for understanding the intricate mechanisms of cell division and growth regulation.
AP2M1 antibody
The AP2M1 antibody is a monoclonal antibody that specifically targets the AP2M1 protein. This protein plays a crucial role in the regulation of insulin and adiponectin signaling pathways. By binding to the AP2M1 protein, this antibody can modulate the activity of adipocytes and promote the growth factor-mediated signaling cascade.SMS antibody
The SMS antibody is a highly specialized monoclonal antibody that targets CD33, a protein found in the Life Sciences field. This antibody has been extensively studied and proven to be effective in inhibiting the activity of CD33, which plays a crucial role in various cellular processes.
C19ORF24 antibody
C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP
