Biochemicals and Reagents

<p>OTSSP167 hydrochloride is a member of the family of small molecules that are used for cancer treatment. It binds to the kinase domain and inhibits the phosphorylation of proteins which are important in cell cycle progression, leading to cell death. OTSSP167 hydrochloride has been shown to inhibit the proliferation of cancer cells in culture and is also active against pluripotent stem cells. The binding affinity for this compound has been determined using various assays, including binding experiments and hydrophobic constant calculations.</p>

<p>3-[(4-Fluorophenyl)methyl]-2-sulfanylidene-1,3-thiazolidin-4-one is an inhibitor of ion channels. It binds to the alpha subunit of voltage gated potassium channels (Kv1.1) and inhibits potassium ion conductance. 3-[(4-Fluorophenyl)methyl]-2-sulfanylidene-1,3-thiazolidin-4-one has been shown to inhibit the binding of peptides and antibodies to receptors. This compound is used as a research tool for cell biology and in studies related to receptor interactions, ion channels, and peptides.</p>

<p>Et receptor antagonist (Pd 145065) is a peptide that binds to the ET receptor. It has been used as a research tool in cell biology, pharmacology and life science. Et receptor antagonist (Pd 145065) is also an inhibitor of the ET receptor that blocks ligand binding to the ET receptors. It is a high purity, water-soluble, white powder with a molecular weight of 1097.24 Da. Et receptor antagonist (Pd 145065) has CAS No. 153049-49-1 and a purity of &gt; 98%.</p>

<p>Camellianin B is a potent inhibitor of kinase activity that has been found in urine and is an analog of the natural product Camellianin A. This compound has been shown to induce apoptosis in Chinese hamster ovary cells and human leukemia cells, making it a promising candidate for medicinal use in cancer treatment. Camellianin B inhibits the cell cycle by targeting specific proteins involved in tumor growth, making it an effective inhibitor of cancer cell proliferation. Its potential as a therapeutic agent for cancer treatment is currently being investigated.</p>

<p>5-Bromo-N-[1-(3-cyclopropyl-1,2,4-oxadiazol-5-yl)cyclohexyl]-2-furamide is a synthetic compound, which is often classified as a small molecule inhibitor or modulator, widely utilized in biochemical and pharmacological research. This compound is typically derived through a series of intricate organic synthesis processes involving selective bromination and cyclization steps that yield its unique structure, with features such as a bromine atom and a cyclopropyl group contributing to its specific biochemical properties.</p>

<p>Glucokinase activator, cpd A is a peptide that can be used as a research tool. The protein interacts with the glucokinase receptor and inhibits it, which is a key enzyme in carbohydrate metabolism. Glucokinase activator, cpd A has been shown to inhibit ion channels, and is an inhibitor of the alpha-subunit of the GABA receptor. It also binds to a number of other receptors. This product has high purity and is CAS No. 603108-44-7.</p>

<p>Amosulalol is a potent, non-selective antagonist of β-adrenoceptors. It is used for the treatment of hypertension and heart failure. Amosulalol binds to β-adrenoceptors in both the diastolic (relaxing) and systolic (contracting) phases of the cardiac cycle, thereby inhibiting the effects of catecholamines. In addition, it has been shown to inhibit cyclase activity and reduce blood pressure in animal models by reducing the activity of renin. Amosulalol also has anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>

<p>(R)-(+)-SKF-38393 Hydrochloride is a potent and selective ligand for the muscarinic M1 receptor. It is used as a research tool to elucidate the role of this receptor in cell biology, pharmacology, and physiology. SKF-38393 binds to the M1 receptor with high affinity and selectivity. SKF-38393 has been shown to activate the M1 receptor by increasing intracellular calcium levels. It also inhibits the binding of acetylcholine to the M2 receptor in vitro. The carboxylic acid group of SKF-38393 can be easily converted into an amide or ester derivative by reacting with ammonia or an acid chloride respectively.</p>

<p>PD 159020 is a 5-HT1B/1D receptor agonist that is used for the treatment of bladder cancer. It inhibits tumor metastases by inhibiting the activation of caspase-8, which leads to tumor cell death. PD 159020 has also been shown to be effective in the treatment of prostate and breast cancers. This drug blocks cellular proliferation by modulating the activity of deuterated irl-1620, a potent anti-neoplastic agent, which is a cytostatic agent that inhibits DNA synthesis and cell division. PD 159020 may also have an effect on malignant cells because it has been shown to inhibit the growth of paclitaxel-resistant human lung adenocarcinoma cells in vitro.</p>

<p>RS 504393 is a potent and selective antagonist of Toll-like receptor 4 (TLR4) that has been shown to inhibit the production of proinflammatory cytokines, chemokines, and nitric oxide. RS 504393 has been shown to be effective in the treatment of bone cancer, as well as in the prevention of renal injury due to tubulointerstitial damage. This drug has also been shown to have anti-inflammatory effects in a model system through inhibition of chemokine production. RS 504393 is an ester hydrochloride salt that binds with high affinity to TLR4 receptors, inhibiting receptor activity by preventing ligand binding.</p>

<p>ICI 154129 is a potent and selective δ-opioid receptor antagonist. It has been shown to produce antinociceptive effects in animal models of pain, and ICI 154129 has been shown to have an addictive potential in animals. ICI 154129 binds to the δ-opioid receptor with high affinity and selectivity, with a K i of 0.5 nM. It also binds to other opioid receptors at higher concentrations, including β-opioid receptors (K i = 1.3 nM) and μ-opioid receptors (K i = 2.6 nM). ICI 154129 is a competitive antagonist at all three opioid receptors, preventing binding of endogenous or exogenous agonists or antagonists. There are very few side effects associated with this drug, which may be due to its low affinity for other targets such as dopamine or serotonin receptors.</p>

<p>HBsAg is the surface antigen of the Hepatitis-B-Virus (HBV). The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen.Recombinant HbsAg ayw full length is a 24kDa protein cloned from HBV 320 genome.</p>

<p>Irreversible inhibitor of HER2 tyrosine kinase</p>

<p>Selective inhibitor of Mycobacterium tuberculosis leucyl-tRNA synthetase</p>

<p>Please enquire for more information about N-Trifluoroacetodesmethyl citalopram-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MS012 is a butyric acid-producing bacteria that was isolated from the roots of S. rebaudiana. It has shown bacteriostatic activity against Gram-positive and Gram-negative bacteria, and it also has inhibitory effects on cancer cells. MS012 produces butyric acid, which is an important signaling molecule for cell growth regulation. The homologous protein sequence of MS012 is highly conserved and belongs to histone H3 family, which plays a key role in regulating gene expression in eukaryotic cells. MS012 has been shown to have potential as a cancer therapy due to its ability to induce histone methylation and increase e3 ubiquitin levels.</p>

<p>Nociceptin is a neuropeptide that acts as an endogenous ligand for the opioid receptor. It has been shown to be an antagonist of opioid receptors, although it also activates potassium channels. Nociceptin has been used as a research tool in pharmacology and protein interactions, where it has been shown to inhibit the binding of opioid receptor-specific antibodies and to activate potassium-selective ion channels. Nociceptin is a high purity peptide with CAS No. 205252-57-9.</p>

<p>(Z)-2-((4-(Phenethylamino)-1-styryl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino)ethan-1-ol is a research tool that is used in cell biology and pharmacology. It is an activator that binds to the receptor and activates it by either increasing or decreasing the activity of ion channels. It also binds to antibodies and inhibits protein interactions. This ligand has been shown to inhibit the activity of ion channels such as potassium channels, calcium channels, sodium channels, and chloride channels.</p>

<p>GSK864 is a small molecule that inhibits pd-l1, a protein that is important for the development of cancer. GSK864 has been shown to inhibit the production of histone H3, which is an essential component of the nucleosome and plays a role in DNA replication and transcription. GSK864 also promotes demethylation and inhibits 2-hydroxyglutarate (HG), which is involved in cellular metabolism and produces energy. This drug also increases production of secretome, which contains proteins that are involved in tumor growth.</p>

<p>3,4-Dihydroxy-5-nitrophenyl)(2-fluorophenyl)methanone (NSC 663128) is a potent and selective growth factor that binds to the dopamine receptor. It has been shown to inhibit protein tyrosine phosphorylation and cell proliferation in vitro. This compound has also been shown to protect against neurotoxicity induced by methamphetamine in rats. NSC 663128 has also demonstrated an anti-cancer effect on human cancer cells, including leukemia cells and breast cancer cells. The mechanism of this effect may be due to inhibition of catechol-o-methyltransferase, epidermal growth factor receptor, or other cellular targets.</p>

<p>GSK-843 is a drug that interacts with the kinase activity of the protein kinase A (PKA), which is an enzyme that phosphorylates proteins. GSK-843 also modulates the PKA and protein kinase C (PKC) activities, which are enzymes involved in cell signaling. Treatment with GSK-843 led to a significant reduction in cell viability and necrotic cell death, as well as reduced hepatic steatosis in animals. This drug has been shown to suppress TNF-α, an inflammatory cytokine, and fatty acid synthase, an enzyme involved in lipid metabolism, which may contribute to its anticancer activity.</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>Rabbit polyclonal OR6P1 antibody</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>Rabbit polyclonal RNMTL1 antibody</p>

<p>Calmodulin antibody was raised in mouse using recombinant human Calmodulin (1-149aa) purified from E. coli as the immunogen.</p>

<p>The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.</p>

<p>MAB21L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR</p>

<p>Rabbit polyclonal FTL antibody (FITC)</p>

<p>The Cortisol monoclonal antibody is a specialized antibody used in the field of Life Sciences. It has been developed to specifically target and bind to cortisol, a hormone that plays a crucial role in various physiological processes. This antibody is widely used in research and diagnostic applications to detect and measure cortisol levels in different biological samples.</p>

<p>Purified recombinant PLIN2 protein (His tag)</p>

<p>TMEM176A antibody was raised using the middle region of TMEM176A corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ</p>

<p>WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS</p>

<p>The CIB1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the epidermal growth factor and has been shown to have neutralizing effects on its activity. This antibody can be used for various applications, including the detection and quantification of influenza hemagglutinin, as well as studying protein kinase signaling pathways. Additionally, the CIB1 antibody has been used in research related to cardiac muscle troponin, electrode development, telomerase activity, dopamine receptors, and human hepatocytes. With its high specificity and versatility, this monoclonal antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>The CD93 antibody is a recombinant antigen that is used in various immunoassays and bioassays. It has been shown to have ultrasensitive detection capabilities and is commonly used in the field of Life Sciences. The CD93 antibody specifically targets the epidermal growth factor and can be used for the detection of this growth factor in human serum samples. This monoclonal antibody is reactive and can be easily detected using techniques such as electrochemical impedance spectroscopy. It is commonly used in intraocular research and has proven to be a valuable tool for studying the role of growth factors in various biological processes.</p>

<p>The Erythropoetin antibody is a chimeric protein that specifically targets and neutralizes erythropoetin. It contains a unique structure with a fatty acid and a cycloalkyl group, which enhances its stability and binding affinity. This monoclonal antibody is activated upon binding to erythropoetin, effectively blocking its interaction with the erythropoetin receptor. By doing so, it inhibits the production of red blood cells, making it a valuable tool in research and diagnostics related to erythropoiesis. Additionally, this antibody has been used in life sciences studies to investigate the role of erythropoietin in various physiological processes such as collagen synthesis, fibrinogen activation, and interferon regulation. Its specificity and high neutralizing activity make it an essential component in many scientific experiments and applications within the field of biotechnology.</p>

<p>Rabbit polyclonal COX5B antibody (biotin)</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDLIM1 antibody, catalog no. 20R-1140</p>

<p>CCNB3 antibody was raised in rabbit using the C terminal of CCNB3 as the immunogen</p>

<p>Rabbit polyclonal UBE2D1 antibody</p>

<p>Purified recombinant ATP1B1 protein (His tag)</p>

<p>Rabbit polyclonal OR2T2 antibody</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>The BTN1A1 antibody is a powerful tool in Life Sciences research. This monoclonal antibody specifically targets BTN1A1, a protein involved in various cellular processes. It has been extensively studied for its role in circovirus infection and hemolysis. Researchers have found that the BTN1A1 antibody can effectively inhibit the activity of BTN1A1, making it a valuable tool for studying the function of this protein.</p>

<p>Rat monoclonal CD11b antibody (PE)</p>

<p>Purified recombinant Human TTC1 protein (His tag)</p>

<p>Rabbit polyclonal Stefin B antibody</p>

<p>Purified recombinant IFT20 protein (His tag)</p>

<p>The IL4 antibody is a low-molecular-weight monoclonal antibody used in Life Sciences. It is designed to neutralize the effects of Interleukin 4 (IL-4), a cytokine that plays a crucial role in immune responses. By binding to IL-4, this antibody prevents its interaction with its receptors, thereby inhibiting downstream signaling pathways.</p>

<p>The CD325 antibody is a monoclonal antibody that is synthesized chemically. It belongs to the group of antibodies known as autoantibodies and has neutralizing properties. This antibody specifically targets insulin, a hormone that regulates blood sugar levels. CD325 antibody can be used for various applications in the field of life sciences, including insulin detection in human serum and research related to hyperinsulinaemic hypoglycaemia. It has been shown to have high specificity and sensitivity in recognizing insulin molecules and can be used in assays to measure insulin levels accurately. The CD325 antibody is a valuable tool for researchers studying the role of insulin in various physiological processes and diseases. Its unique properties make it an essential component in studies involving insulin and related molecules.</p>

<p>Rabbit polyclonal COMMD4 antibody (FITC)</p>

<p>KLHL1 antibody was raised in rabbit using the middle region of KLHL1 as the immunogen</p>

<p>EIF2S1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 2, Subunit 1 Alpha, 35Kda</p>

<p>Mouse monoclonal CAMLG antibody</p>

<p>The CD146 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to CD146, a protein expressed on the surface of various cell types. This antibody has been extensively studied and proven to be effective in numerous applications.</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Mouse monoclonal MKI67 antibody</p>

<p>SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL</p>

<p>STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has proven its high activity in human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>AFP antibody was raised against Human Alfafetoprotein (AFP).</p>

<p>ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen</p>

<p>SLCO1A2 antibody was raised in rabbit using the middle region of SLCO1A2 as the immunogen</p>

<p>Rabbit polyclonal SNX19 antibody</p>

<p>Rabbit polyclonal WFDC2 antibody (HRP)</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK</p>

<p>CD1d antibody is a monoclonal antibody that targets CD1d, a protein involved in immune responses. It has been shown to have potential therapeutic applications in various fields of life sciences. CD1d antibody can be used for research purposes, such as studying the role of CD1d in immune system function and identifying potential therapeutic targets for diseases like choroidal neovascularization and cryptosporidium infection. Additionally, this antibody can be utilized in nuclear assays to detect and analyze the expression of CD1d in different cell types. The use of CD1d antibody provides researchers with a valuable tool to further understand the complex mechanisms of immune response and develop innovative treatments.</p>

<p>Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Rabbit polyclonal RUFY2 antibody</p>

<p>Purified recombinant POP4 protein (His tag)</p>

<p>ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>SIRT1 antibody was raised in Mouse using a purified recombinant fragment of human SIRT1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Mouse brain antibody (FITC) was raised in rabbit using brain tissue from Balb/c mice as the immunogen.</p>

<p>The HDAC1 antibody is a highly specialized antibody that is used for various research purposes. It is commonly used in studies involving human serum, electrode, casein, and inhibitory factors. This antibody specifically targets the HDAC1 protein, which is an important enzyme involved in gene regulation. The HDAC1 antibody can be used in both monoclonal and polyclonal forms, depending on the specific research needs. It is a glycoprotein that binds to the HDAC1 protein with high affinity, allowing for accurate detection and analysis. Researchers can use this antibody to study various aspects of gene expression, including messenger RNA levels and oncostatin signaling pathways. The HDAC1 antibody is produced using advanced techniques that ensure high specificity and sensitivity. It contains primary amino acids and cysteine disulfide bonds that contribute to its stability and effectiveness. Whether you are studying gene regulation or conducting experiments in molecular biology, the HDAC1 antibody is an essential tool for your research endeavors.</p>

<p>The Myogenin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the alpha-fetoprotein, which is a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be highly effective in binding to the alpha-fetoprotein, making it an essential tool for researchers studying its function and potential therapeutic applications.</p>

<p>Purified native Mouse Haptoglobin protein</p>

<p>Rabbit polyclonal HXA5 antibody</p>

<p>The beta Catenin antibody is a growth factor that belongs to the class of antibodies. It acts as an inhibitor, blocking the action of other antibodies and chemokines. In the field of Life Sciences, this monoclonal antibody is widely used as a test compound for various experiments. It specifically targets beta catenin, a nuclear protein involved in cell signaling and adhesion. This antibody has a neutralizing effect on beta catenin, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, it has been shown to inhibit endothelial growth and interfere with interferon-gamma (IFN-gamma) signaling. The beta Catenin antibody is an essential tool for researchers in the field of Life Sciences looking to study and manipulate cellular processes involving beta catenin.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Mouse monoclonal IFT57 antibody</p>

<p>Purified Polyclonal CRHR1 antibody</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fxn antibody, catalog no. 70R-8779</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR1D antibody, catalog no. 70R-2039</p>

<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RANBP9 antibody</p>

<p>ZNF491 antibody was raised in rabbit using the N terminal of ZNF491 as the immunogen</p>

<p>Rabbit polyclonal SENP8 antibody</p>

<p>Mouse monoclonal AMPKa1 antibody (N-terminus)</p>

<p>Purified recombinant Human CD83 protein (His tag)</p>

<p>Lymphotoxin alpha antibody is a highly specialized medicament used in Life Sciences research. It is an inhibitor that targets adeno-associated virus and plays a crucial role in pluripotent stem cells. This antibody has been extensively used in assays to study the effects of test compounds on interleukin production. Lymphotoxin alpha antibody possesses high affinity for its ligands and has been employed in the isolation of autoantibodies and extracellular markers. Its unique properties make it an indispensable tool for researchers studying various biological processes, including those related to the retina.</p>

<p>Rabbit polyclonal UMOD antibody</p>

<p>COPS7A antibody was raised using a synthetic peptide corresponding to a region with amino acids NLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGL</p>

<p>The SOX5 antibody is a monoclonal antibody that targets the catechol-O-methyltransferase (COMT) enzyme. It is widely used in Life Sciences research as a biomolecule for various applications. This antibody specifically recognizes and binds to the activated form of COMT, inhibiting its enzymatic activity. By neutralizing COMT, the SOX5 antibody modulates dopamine levels, which plays a crucial role in several physiological processes.</p>

<p>ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM</p>

<p>Mouse monoclonal DCXR antibody</p>