Biochemicals and Reagents

<p>Purified Polyclonal KLK11 antibody</p>

<p>4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) is a ligand that binds to the GABAA receptor. It has been shown to activate this receptor by binding to the alpha subunit of the GABAAR. This receptor is responsible for mediating inhibitory signals in the brain. Activation of this receptor leads to an increase in chloride ion influx, which causes hyperpolarization of neurons and thus reduces neuronal activity. 4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) has also been shown to be a competitive inhibitor of peptides that bind to the GABAA receptor, such as baclofen and muscimol.<br>!--END--&gt;</p>

<p>The SIAH1 antibody is a highly specialized antibody that targets the phosphatase histidine. It exhibits cytotoxic properties and is commonly used in multidrug treatments. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. It has been extensively used in various life sciences applications, including ophthalmic formulations, chemokine studies, hybridization assays, growth factor research, and immunoassays. The SIAH1 antibody is known for its high specificity and sensitivity, making it a valuable tool for scientists studying cellular signaling pathways and protein regulation. Whether you're conducting basic research or developing new therapeutic approaches, this antibody is an essential component of your toolkit.</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>p53 antibody was raised in mouse using recombinant human p53 (transcription domain within the NH2 terminus) as the immunogen.</p>

<p>ITGB3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal UROS antibody</p>

<p>MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The SNX27 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target thrombocytopenia, a condition characterized by low platelet count. This powerful antibody works by binding to specific receptors on the surface of platelets, promoting their activation and preventing their destruction. In addition to its role in treating thrombocytopenia, the SNX27 antibody has also shown promise in other areas of research. It can be used in assays to detect and quantify various proteins, such as collagen and anti-mesothelin antibodies. Furthermore, this antibody has been found to inhibit the activity of urokinase plasminogen activator, an enzyme involved in blood clot dissolution. With its cytotoxic properties and ability to neutralize inhibitors present in human serum, the SNX27 antibody is a valuable tool for both laboratory research and therapeutic applications.</p>

<p>EWSR1 antibody was raised in rabbit using the middle region of EWSR1 as the immunogen</p>

<p>Rabbit polyclonal VASP antibody (Ser157)</p>

<p>The NUMB antibody is a monoclonal antibody that specifically targets adiponectin, a growth factor found in adipose tissue. This antibody is widely used in Life Sciences research to study the role of adiponectin in various physiological processes. It has been shown to be effective in detecting and quantifying adiponectin levels in samples such as serum, plasma, and cell lysates. The NUMB antibody can also be used for immunohistochemistry and Western blot analysis to visualize the expression of adiponectin in different tissues. Additionally, this antibody has been used to investigate the presence of autoantibodies against adiponectin in certain diseases, including insulin resistance and diabetes. Its high specificity and sensitivity make it a valuable tool for researchers studying adipocyte biology and related disorders.</p>

<p>The RABEP1 antibody is a polyclonal antibody that has high specificity for interferon and alpha-fetoprotein. It recognizes specific glycan and fatty acid molecules and can be used in various applications in the field of Life Sciences. This monoclonal antibody exhibits high specific activity, making it a valuable tool for research purposes. It can be used to detect the presence of RABEP1 protein in samples such as human serum or cell lysates. Additionally, this antibody has been shown to have superoxide activity and may play a role in regulating lipoprotein lipase activity. With its versatility and reliability, the RABEP1 antibody is an essential component for any laboratory conducting research in these areas.</p>

<p>PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK</p>

<p>LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF</p>

<p>Rabbit polyclonal M3KE20 antibody</p>

<p>PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL</p>

<p>SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL</p>

<p>The BCL2 antibody is a highly specialized monoclonal antibody that targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival. This antibody specifically binds to the BCL2 protein, inhibiting its function and promoting apoptosis (cell death) in cancer cells.</p>

<p>Purified recombinant ARSM2 protein (His tag)</p>

<p>Mouse monoclonal SSR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPH2 antibody, catalog no. 70R-3317</p>

<p>Rabbit polyclonal XDH antibody</p>

<p>PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT</p>

<p>The Rex1 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in assays and immunohistochemical studies to detect the presence of Rex1, a protein expressed in pluripotent stem cells. This antibody has been shown to be highly specific and sensitive, making it an ideal tool for studying the properties and behavior of stem cells. Additionally, the Rex1 antibody can be used as an inhibitor to block the activity of Rex1, allowing researchers to investigate its function and role in cellular processes. Its application extends beyond basic research, as it has potential uses in the development of new medicines and therapies targeting pluripotent stem cells. With its unique ability to recognize and bind to Rex1, this antibody offers valuable insights into the complex mechanisms underlying cell differentiation and development.</p>

<p>Rabbit Polyclonal ELOVL4 antibody</p>

<p>The XPA antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the XPA protein, which plays a crucial role in DNA repair. This antibody is commonly used in studies involving mesenchymal stem cells, as well as in investigations related to thrombocytopenia and growth factors. The XPA antibody can also be utilized for the detection and quantification of various chemokines, antibodies, inhibitors, collagens, and other proteins of interest. Its high specificity and affinity make it an invaluable tool for researchers looking to understand the molecular mechanisms underlying different biological processes. With its colloidal properties and ability to bind to specific epitopes, this monoclonal antibody offers accurate and reliable results. Additionally, its low viscosity allows for easy handling and efficient use in various experimental protocols.</p>

<p>Rabbit polyclonal B3GALT1 antibody</p>

<p>Cyclobenzaprine-D3 hydrochloride is a synthetic tricyclic compound that has been used as a research tool in the field of pharmacology and cell biology. Cyclobenzaprine-D3 hydrochloride is a potent ligand for the alpha-2A receptor, but it also inhibits the binding of serotonin to its receptors. Cyclobenzaprine-D3 hydrochloride binds to the receptor and can be used as an activator or inhibitor, depending on the type of experiment being run. Cyclobenzaprine-D3 hydrochloride is a high purity reagent.</p>

<p>Mouse monoclonal anti human C1QBP antibody</p>

<p>Rabbit polyclonal HMG14 antibody</p>

<p>The Caspase 6 antibody is a highly effective monoclonal antibody used in Life Sciences. This glycoprotein antibody specifically targets caspase 6, an enzyme involved in programmed cell death. By binding to caspase 6, this antibody inhibits its activity and prevents the initiation of apoptosis.</p>

<p>The RPA1 antibody is a monoclonal antibody that targets fatty acids and has antiviral properties. It specifically binds to cellulose and lipoprotein lipase, inhibiting their activity. This antibody also interacts with interferons, playing a role in immune response modulation. In the field of Life Sciences, RPA1 antibody is widely used for its neutralizing effects on various growth factors. Additionally, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases due to its ability to target autoantibodies. With its acid modifications, this antibody offers enhanced stability and efficacy in research and diagnostic applications.</p>

<p>ZNF252 antibody was raised in rabbit using the middle region of ZNF252 as the immunogen</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP</p>

<p>Mouse monoclonal MSS1 antibody</p>

<p>HSV1 enriched cell lysate</p>

<p>Rabbit polyclonal SNX7 antibody</p>

<p>Mouse monoclonal SCHIP1 antibody</p>

<p>The Androgen Receptor Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to the androgen receptor, a protein that plays a crucial role in cell growth and development. By binding to the androgen receptor, this antibody inhibits its activation, thereby preventing the downstream signaling pathways involved in cell proliferation.</p>

<p>Rabbit polyclonal RBX1 antibody</p>

<p>TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL</p>

<p>GPR81 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Biotin is a coenzyme that is used to attach other molecules, such as proteins, to other molecules. Biotinylated fatty acids are used in the production of biotin-binding peptides and cell surface receptors for protein-protein interactions. Biotinylated fatty acids are also used as research tools in pharmacology and cell biology.</p>

<p>The CD42b antibody is a highly specific monoclonal antibody that targets nuclear β-catenin. It is widely used in Life Sciences research for its neutralizing properties and ability to detect and quantify β-catenin levels. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting.</p>

<p>Purified recombinant TOMM34 protein (His tag)</p>

<p>The PD1 antibody is a monoclonal antibody that has been developed as a pneumococcal vaccine. It works by targeting and binding to the PD1 receptor on immune cells, which helps to enhance the body's immune response against pneumococcal infections. In addition to its role in immunity, the PD1 antibody also has other potential applications in the field of life sciences.</p>

<p>Rabbit polyclonal Androgen Receptor antibody (Ser213)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Furthermore, this medication selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>COLEC12 antibody was raised in rabbit using the middle region of COLEC12 as the immunogen</p>

<p>The Keratin 7 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets the tyrosine residues on Keratin 7, which is a protein found in the epithelial cells of various tissues. By binding to these residues, the Keratin 7 antibody promotes cell growth and differentiation.</p>

<p>Mouse monoclonal ST13 antibody</p>

<p>QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA</p>

<p>5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione is a synthetic chemical compound known for its role as a biochemical intermediate. This compound is synthesized through a controlled chemical process involving the reaction of relevant precursors under specific conditions, typically in a laboratory setting, making it an artificial construct rather than a naturally occurring substance.</p>

<p>Rabbit polyclonal SH3D19 antibody</p>

<p>The CCP2 antibody is a highly specialized and potent intracellular antibody that targets a specific growth factor. This glycopeptide antibody is designed to neutralize the activity of the growth factor, preventing its binding to receptors and subsequent signaling pathways. The CCP2 antibody is a polyclonal antibody, meaning it is derived from multiple sources and recognizes multiple epitopes on the target molecule. It is produced using state-of-the-art techniques in Life Sciences research.</p>

<p>Purified recombinant Mouse LGALS4 protein</p>

<p>MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV</p>

<p>Rabbit polyclonal PYK2 antibody (Tyr580)</p>

<p>β1-selective adrenergic receptor antagonist</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Rabbit polyclonal SFRS5 antibody</p>

<p>JD 5037 is a monoclonal antibody that inhibits the binding of endocannabinoids to their receptors. This drug has been shown to be effective in animal models of obesity, diabetes, and cancer. JD 5037 binds to the CB2 receptor and antagonizes the effects of endocannabinoids by preventing them from binding. The high affinity of this drug for the CB2 receptor may be due to its tautomeric structure. This drug also appears to have potential as an anticancer agent due to its ability to bind and inhibit rapamycin complex-1 (raptor) and cb2 receptor.</p>

<p>Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.</p>

<p>The ACSS2 antibody is a highly specific monoclonal antibody that has been developed for use in various applications within the Life Sciences field. This antibody is designed to target and bind to ACSS2, an enzyme involved in cellular metabolism. By specifically targeting ACSS2, this antibody can be used to study the role of this enzyme in various cellular processes.</p>

<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL</p>

<p>Rabbit polyclonal RAB3IL1 antibody</p>

<p>DBH antibody was raised in mouse using bovine DBH protein as the immunogen.</p>

<p>Purified recombinant HSPA5 protein (His tag)</p>

<p>Human synthetic phosphopeptide (Thr77) region immunogen, Purified Rabbit polyclonal Cyclin E1 antibody (Thr77)</p>

<p>Purified recombinant Human LITAF protein (His tag)</p>

<p>The NPM antibody is a highly reactive antibody that specifically targets Nucleophosmin (NPM), a multifunctional protein involved in various cellular processes. This antibody has been extensively used in research and diagnostics due to its ability to detect NPM in human serum and tissues.</p>

<p>ApoB antibody was raised in mouse using human serum LDL as the immunogen.</p>

<p>DENND1B antibody was raised using the middle region of DENND1B corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY</p>

<p>Rabbit polyclonal OR2I1 antibody</p>

<p>Purified recombinant SYNJ2BP protein (His tag)</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY</p>

<p>Rabbit polyclonal MARCHVIII antibody</p>

<p>The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.</p>

<p>Clcn5 antibody was raised in rabbit using the middle region of Clcn5 as the immunogen</p>

<p>The CDCP1 antibody is a highly effective monoclonal antibody that specifically targets the CDCP1 protein. This antibody is designed to bind to and neutralize the activity of CDCP1, which plays a crucial role in various cellular processes. By blocking the function of CDCP1, this antibody inhibits the formation of CDCP1 dimers and prevents its activation.</p>

<p>GW-590735 is a potent, non-peptide, orally bioavailable, small molecule activator of PPARs. It binds to the PPAR receptor and activates it by binding to the ligand binding domain, thereby increasing the expression of genes that are involved in lipid metabolism. GW-590735 has been shown to have anti-inflammatory effects in animal models of bowel disease, as well as beneficial effects on insulin sensitivity and energy homeostasis. GW-590735 has also been shown to activate PPARγ in cancer cells and reduce tumor growth. In addition, this drug has been shown to be effective for treatment of inflammatory diseases such as rheumatoid arthritis and Crohn's disease.</p>

<p>Zopiclone Conjugate for use in immunoassays</p>

<p>CSRP2 antibody was raised in rabbit using the C terminal of CSRP2 as the immunogen</p>

<p>CD9 antibody (FITC) was raised in mouse using human CD9 as the immunogen.</p>

<p>Rabbit polyclonal BBTI10 antibody</p>

<p>Rabbit polyclonal RABL2B antibody</p>

<p>PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV</p>

<p>FSH antibody was raised in mouse using human FSH from pituitary as the immunogen.</p>

<p>MIP3 alpha antibody was raised in mouse using highly pure recombinant human MIP-3 alpha as the immunogen.</p>

<p>WT1 antibody was raised in rabbit using the N terminal of WT1 as the immunogen</p>

<p>Rabbit polyclonal Myc antibody (Ser62)</p>

<p>Purified Polyclonal RAC2 antibody</p>

<p>HOXB5 antibody was raised in mouse using recombinant Human Homeo Box B5</p>

<p>Rabbit polyclonal SHROOM1 antibody</p>

<p>Peptide YY antibody was raised in guinea pig using synthetic porcine peptide TT as the immunogen.</p>

<p>RPS13 antibody was raised using the middle region of RPS13 corresponding to a region with amino acids ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES</p>

<p>hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.</p>