Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,865 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SLAM antibody
The SLAM antibody is a human protein that is widely used in Life Sciences research. It is a monoclonal antibody that specifically targets autoantibodies and inhibitors in human serum. The SLAM antibody has been extensively studied for its ability to bind to nuclear proteins, particularly those involved in growth factor signaling pathways. This antibody has also shown promising results in studies involving the detection of vasoactive intestinal peptide and dopamine using electrochemical impedance techniques. With its high specificity and affinity for target molecules, the SLAM antibody is an invaluable tool for researchers in various fields.CYP20A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP20A1 antibody, catalog no. 70R-7506
Purity:Min. 95%RALGDS antibody
RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDZNF286 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF286 antibody, catalog no. 20R-1219Purity:Min. 95%KIAA0182 antibody
KIAA0182 antibody was raised using the N terminal of KIAA0182 corresponding to a region with amino acids EEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPANKRD32 antibody
ANKRD32 antibody was raised in rabbit using the N terminal of ANKRD32 as the immunogenHP1BP3 antibody
HP1BP3 antibody was raised using the middle region of HP1BP3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL
ACLY antibody
ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATEC antibody
TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the middle region of ZKSCAN1 as the immunogen
Purity:Min. 95%Presenilin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN2 antibody, catalog no. 70R-5685Purity:Min. 95%NOX4 antibody
The NOX4 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the NOX4 protein isoforms. This monoclonal antibody is widely used in research laboratories and pharmaceutical companies for various applications.RAC1 antibody
RAC1 antibody was raised in mouse using recombinant protein containing the full length human rac1 as the immunogen.PPARG antibody
The PPARG antibody is a reactive diagnostic reagent that specifically binds to the target molecule. This antibody is a basic protein that forms disulfide bonds and has neutralizing properties. It can be used in Life Sciences research, as well as in drug development and diagnostic applications. The PPARG antibody is commonly used to detect alpha-fetoprotein and autoantibodies in human serum samples. It can also be used in immunoassays, such as ELISA or Western blotting, to study the expression of the CD3 receptor or collagen. With its high specificity and sensitivity, the PPARG antibody is an essential tool for researchers in various fields.PRAME Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRAME antibody, catalog no. 70R-2630Purity:Min. 95%C15ORF26 antibody
C15ORF26 antibody was raised using the C terminal Of C15Orf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVAvil Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Avil antibody, catalog no. 70R-7868Purity:Min. 95%ZNF131 antibody
ZNF131 antibody was raised in rabbit using the middle region of ZNF131 as the immunogen
Purity:Min. 95%TH1L antibody
TH1L antibody was raised in rabbit using the N terminal of TH1L as the immunogenPurity:Min. 95%TMEM161A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM161A antibody, catalog no. 70R-6879Purity:Min. 95%ZDHHC18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC18 antibody, catalog no. 70R-7061Purity:Min. 95%BBS4 antibody
BBS4 antibody was raised using the N terminal of BBS4 corresponding to a region with amino acids YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAACRABP1 protein
1-137 amino acids: MPNFAGTWKM RSSENFDELL KALGVNAMLR KVAVAAASKP HVEIRQDGDQ FYIKTSTTVR TTEINFKVGE GFEEETVDGR KCRSLATWEN ENKIHCTQTL LEGDGPKTYW TRELANDELI LTFGADDVVC TRIYVREPurity:Min. 95%HGD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HGD antibody, catalog no. 70R-2873Purity:Min. 95%NEURL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NEURL2 antibody, catalog no. 70R-4136Purity:Min. 95%NODAL antibody
NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHDCP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DCP2 antibody, catalog no. 70R-4870Purity:Min. 95%C6orf154 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf154 antibody, catalog no. 70R-4433Purity:Min. 95%PDP2 antibody
PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVPR8 antibody
The PR8 antibody is a highly specialized collagen antibody that targets specific proteins in the body. It has been extensively studied and proven to inhibit the activity of protein kinases, which play a crucial role in various cellular processes. This antibody has also been shown to effectively block the interaction between peptide mimics and microvessel endothelial cells, preventing the formation of abnormal blood vessels.CYP2C18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2C18 antibody, catalog no. 70R-5409Purity:Min. 95%GSTA1 protein
1-222 amino acids: MAEKPKLHYF NARGRMESTR WLLAAAGVEF EEKFIKSAED LDKLRNDGYL MFQQVPMVEI DGMKLVQTRA ILNYIASKYN LYGKDIKERA LIDMYIEGIA DLGEMILLLP VCPPEEKDAK LALIKEKIKN RYFPAFEKVL KSHGQDYLVG NKLSRADIHL VELLYYVEEL DSSLISSFPL LKALKTRISN LPTVKKFLQP GSPRKPPMDE KSLEEARKIF RFPurity:>90% By Sds-PageTRAF1 protein (His tag)
266-416 amino acids: MGSSHHHHHH SSGLVPRGSH MDGTFLWKIT NVTRRCHESA CGRTVSLFSP AFYTAKYGYK LCLRLYLNGD GTGKRTHLSL FIVIMRGEYD ALLPWPFRNK VTFMLLDQNN REHAIDAFRP DLSSASFQRP QSETNVASGC PLFFPLSKLQ SPKHAYVKDD TMFLKCIVET STPurity:Min. 95%Influenza B antibody (biotin)
Influenza B antibody (biotin) was raised in goat using the yamagata strain of influenza B as the immunogen.
ARHGAP15 antibody
ARHGAP15 antibody was raised in rabbit using the middle region of ARHGAP15 as the immunogenPurity:Min. 95%MSI2 antibody
MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELSMPDL3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMPDL3B antibody, catalog no. 70R-5357Purity:Min. 95%Estrogen Receptor alpha antibody (Ser167)
Rabbit polyclonal Estrogen Receptor alpha antibody (Ser167)NKAIN4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN4 antibody, catalog no. 70R-7530Purity:Min. 95%ERBB3 antibody
The ERBB3 antibody is a growth factor that belongs to the class of polyclonal antibodies. It is designed to target and neutralize the epidermal growth factor receptor (EGFR), which plays a crucial role in cell proliferation and survival. This antibody specifically binds to EGFR, preventing its activation by hormone peptides such as vasoactive intestinal peptide or epinephrine. By blocking EGFR signaling, the ERBB3 antibody inhibits the growth and spread of cancer cells.Purity:Min. 95%Calpastatin protein (Domain 1)
Purified recombinant Human Calpastatin protein (Domain 1)Purity:Min. 95%p53 antibody
The p53 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences for various applications. This antibody is specifically designed to bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By targeting this protein, the p53 antibody can be used to study its activation status and evaluate its potential as a therapeutic target.
SIAH1 antibody
SIAH1 antibody was raised in rabbit using the C terminal of SIAH1 as the immunogenPurity:Min. 95%ACCN1 antibody
ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
Rabbit anti Mouse IgM (HRP)
Rabbit anti-mouse IgM (HRP) was raised in rabbit using murine IgM mu chain as the immunogen.Purity:Min. 95%FBXL14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL14 antibody, catalog no. 70R-3779Purity:Min. 95%Tektin 4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TEKT4 antibody, catalog no. 70R-3595
Purity:Min. 95%PELI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PELI1 antibody, catalog no. 70R-3450Purity:Min. 95%TEX264 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TEX264 antibody, catalog no. 70R-7283Purity:Min. 95%NPTX2 antibody
NPTX2 antibody was raised in rabbit using the middle region of NPTX2 as the immunogen
Purity:Min. 95%hCG_20426 antibody
hCG_20426 antibody was raised in rabbit using the N terminal of HCG_20426 as the immunogenPurity:Min. 95%Histone H4 antibody
The Histone H4 antibody is a polyclonal antibody that specifically binds to the amino-terminal region of Histone H4. Histones are a group of highly basic and acidic proteins that play a crucial role in DNA packaging and gene regulation. This antibody is widely used in Life Sciences research to study the binding proteins, hormone regulation, and various cellular processes.cFLIP antibody
The cFLIP antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and neutralize the activity of cFLIP, a glycoprotein that plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in blocking the activity of cFLIP, making it an invaluable tool for researchers studying this protein.
Tau antibody
The Tau antibody is a highly specialized monoclonal antibody that targets and binds to tau proteins in the brain. Tau proteins play a crucial role in stabilizing microtubules, which are responsible for maintaining the structure and function of neurons. However, in neurodegenerative diseases such as Alzheimer's, tau proteins become abnormally phosphorylated and form tangles, leading to neuronal dysfunction and cognitive decline.Purity:Min. 95%SSBP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP3 antibody, catalog no. 70R-3546Purity:Min. 95%TGF β 1 antibody
TGF beta 1 antibody was raised in Mouse using a purified recombinant fragment of TGFbeta1 expressed in E. coli as the immunogen.CBR4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CBR4 antibody, catalog no. 70R-10143
Purity:Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%SLC17A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC17A2 antibody, catalog no. 70R-7000Purity:Min. 95%CLPB antibody
CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALVGalectin 3 antibody
Galectin 3 antibody is an essential tool used in Life Sciences research. It is a polyclonal antibody that specifically targets galectin 3, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of galectin 3.PRMT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT1 antibody, catalog no. 70R-1243Purity:Min. 95%GGTL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GGTL3 antibody, catalog no. 70R-6413Purity:Min. 95%GALE antibody
GALE antibody was raised in rabbit using the middle region of GALE as the immunogenPurity:Min. 95%
