Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,854 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(528 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C1orf104 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf104 antibody, catalog no. 70R-3998
Purity:Min. 95%PAXIP1 antibody
PAXIP1 antibody was raised in rabbit using the N terminal of PAXIP1 as the immunogenPurity:Min. 95%Noggin protein (Mouse)
Region of Noggin protein corresponding to amino acids MQHYLHIRPA PSDNLPLVDL IEHPDPIFDP KEKDLNETLL RSLLGGHYDP GFMATSPPED RPGGGGGPAG GAEDLAELDQ LLRQRPSGAM PSEIKGLEFS EGLAQGKKQR LSKKLRRKLQ MWLWSQTFCP VLYAWNDLGS RFWPRYVKVG SCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC.Purity:Min. 95%CCDC7 antibody
CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKIADAD2 antibody
ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFRAB9A antibody
RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogenPurity:Min. 95%Lipase J antibody
Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
GIMAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GIMAP1 antibody, catalog no. 70R-6386Purity:Min. 95%Claudin 15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN15 antibody, catalog no. 70R-1688
Purity:Min. 95%KLK1 antibody
The KLK1 antibody is a polyclonal antibody that is used in life sciences research. It is designed to target and neutralize the effects of acetylcholine, interferon, chemokine, and other molecules involved in intraocular endothelial growth. This antibody has been shown to be effective in blocking the activity of these molecules, thereby inhibiting their effects on cell growth and function. Additionally, the KLK1 antibody can be used to detect the presence of autoantibodies or test compounds in biological samples. Its high specificity and affinity make it an essential tool for researchers studying growth factors and their role in various physiological processes.
Prr16 antibody
Prr16 antibody was raised in rabbit using the N terminal of Prr16 as the immunogenPurity:Min. 95%RERG antibody
RERG antibody was raised in rabbit using the C terminal of RERG as the immunogen
Purity:Min. 95%Omp Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Omp antibody, catalog no. 70R-9418
Purity:Min. 95%p90RSK antibody
The p90RSK antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the antigen binding domain of the p90RSK protein, which plays a crucial role in various cellular processes. This antibody is commonly used in experiments involving electrode and flow assays to study the function and activity of p90RSK.
Purity:Min. 95%STAT1 antibody
The STAT1 antibody is a highly specialized monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This antibody is commonly used in life sciences research to study various cellular processes, including growth factor signaling, insulin regulation, and immune responses.
CHRNA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHRNA3 antibody, catalog no. 70R-5188Purity:Min. 95%CD325 antibody
The CD325 antibody is a highly specialized monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. It is commonly used in life sciences research to study the role of β-catenin in various cellular processes. The CD325 antibody specifically recognizes the non-phosphorylated form of β-catenin, allowing for precise detection and analysis.SMUG1 antibody
The SMUG1 antibody is a highly specific and potent antibody that can be used in various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with flexibility in their experimental design.
RANBP5 antibody
RANBP5 antibody was raised in rabbit using the N terminal of RANBP5 as the immunogen
Purity:Min. 95%MMP13 antibody
The MMP13 antibody is a highly specific monoclonal antibody that targets and inhibits the activity of matrix metalloproteinase 13 (MMP13). MMP13 is an enzyme involved in the breakdown of extracellular matrix components, such as collagen, and plays a crucial role in tissue remodeling and wound healing. This antibody binds to MMP13 with high affinity, effectively blocking its enzymatic activity.HSP27 antibody
The HSP27 antibody is a highly specialized tool used in Life Sciences research. It is designed to target and bind to the Heat Shock Protein 27 (HSP27), a protein involved in cellular stress response and regulation. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA).
Purity:Min. 95%SBDS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SBDS antibody, catalog no. 70R-1181Purity:Min. 95%HDAC7 antibody
The HDAC7 antibody is a polyclonal antibody that specifically targets and neutralizes the activity of HDAC7, a protein involved in various cellular processes. This antibody has been extensively studied and proven to effectively inhibit the activation of TGF-beta, a growth factor that plays a crucial role in cell proliferation and differentiation. By blocking the activity of HDAC7, this antibody prevents the formation of a protein complex that is essential for TGF-beta signaling. Additionally, the HDAC7 antibody has been shown to have inhibitory effects on the expression of androgen-regulated proteins such as ferritin and mucin. With its potent neutralizing properties, this antibody is widely used in life sciences research as well as in the development of novel therapeutic inhibitors targeting HDAC7.Src antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Through various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it is metabolized into oxidative metabolites. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its potent properties and mechanisms of action, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective choice for treating tuberculosis infections.Purity:Min. 95%PLP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLP1 antibody, catalog no. 70R-6999Purity:Min. 95%SOD2 protein (His tag)
25-222 amino acids: MGSSHHHHHH SSGLVPRGSH MKHSLPDLPY DYGALEPHIN AQIMQLHHSK HHAAYVNNLN VTEEKYQEAL AKGDVTAQIA LQPALKFNGG GHINHSIFWT NLSPNGGGEP KGELLEAIKR DFGSFDKFKE KLTAASVGVQ GSGWGWLGFN KERGHLQIAA CPNQDPLQGT TGLIPLLGID VWEHAYYLQY KNVRPDYLKA IWNVINWENV TERYMACKKPurity:Min. 95%Man2a2 antibody
Man2a2 antibody was raised in rabbit using the N terminal of Man2a2 as the immunogenPurity:Min. 95%SP140 antibody
SP140 antibody was raised in rabbit using the N terminal of SP140 as the immunogenPurity:Min. 95%ABTS Substrate
ABTS Substrate is a versatile compound commonly used in Life Sciences research. It is widely utilized as a substrate for various enzymatic reactions, including the measurement of enzyme activity and the detection of specific biomolecules. ABTS Substrate is particularly useful in assays involving fibrinogen, actin filaments, and other proteins.Purity:Min. 95%PRKCG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRKCG antibody, catalog no. 70R-5850Purity:Min. 95%Reck antibody
Reck antibody was raised in rabbit using the middle region of Reck as the immunogen
Purity:Min. 95%5HT2B antibody
The 5HT2B antibody is a hematopoietic protein that can be used therapeutically as a biomarker. It is commonly used in immunohistochemical methods to detect the presence of specific antigens in tissues. This antibody is widely used in life sciences research as a reagent for various applications, including immunohistochemical staining and the study of inhibitors and cytokines. Additionally, the 5HT2B antibody plays a crucial role in pluripotent stem cell research and can be utilized to identify and characterize these cells. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in the field of molecular biology and cellular research.WNT16 antibody
WNT16 antibody was raised using the C terminal of WNT16 corresponding to a region with amino acids REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGHeme Oxygenase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HMOX1 antibody, catalog no. 70R-5993Purity:Min. 95%cMyc antibody
The cMyc antibody is a highly versatile antibody used in various research applications in the field of Life Sciences. It can be used as both polyclonal and monoclonal antibodies, making it suitable for different experimental setups. This antibody specifically targets the cMyc protein, which plays a crucial role in cell growth and proliferation.DNAJB5 antibody
DNAJB5 antibody was raised in rabbit using the N terminal of DNAJB5 as the immunogenPurity:Min. 95%FABP5 protein
1-135 amino acids: MATVQQLEGR WRLVDSKGFD EYMKELGVGI ALRKMGAMAK PDCIITCDGK NLTIKTESTL KTTQFSCTLG EKFEETTADG RKTQTVCNFT DGALVQHQEW DGKESTITRK LKDGKLVVEC VMNNVTCTRI YEKVEPurity:>90% By Sds-PageProgesterone Receptor Antibody
The Progesterone Receptor Antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the progesterone receptor, which plays a crucial role in reproductive processes and hormone signaling. The antibody is designed to recognize the activated form of the progesterone receptor, allowing for precise detection and analysis.Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%MGP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGP antibody, catalog no. 70R-5433
Purity:Min. 95%CMA1 antibody
CMA1 antibody was raised in rabbit using the C terminal of CMA1 as the immunogenPurity:Min. 95%RAN antibody
RAN antibody is a highly effective neutralizing agent that targets cyclase-activating fatty acid receptors. This polyclonal antibody has been extensively tested and proven to inhibit the activity of these receptors, which play a crucial role in low-density lipoprotein metabolism. The RAN antibody is also capable of blocking interferon signaling pathways, making it an invaluable tool for researchers studying the immune response. In addition to its high specificity, this monoclonal antibody is formulated with excipients that ensure stability and long shelf life. It can be used in various assays, including IFN-gamma detection and antigen detection. With its exceptional binding affinity and reliable performance, the RAN antibody is a valuable asset for any laboratory or research facility working on lipid metabolism or immune system studies.MED4 antibody
MED4 antibody was raised in rabbit using the C terminal of MED4 as the immunogen
Purity:Min. 95%CTDSP2 antibody
CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVPHYHIPL antibody
PHYHIPL antibody was raised in rabbit using the C terminal of PHYHIPL as the immunogenPurity:Min. 95%Factor XI protein
Factor XI protein is a monoclonal antibody that acts as a phosphatase in Life Sciences. It is commonly used as a colony-stimulating factor and has been shown to have neutralizing effects on certain dimers, such as the a1 protein and GM-CSF. Factor XI protein also interacts with calmodulin and can inhibit the production of autoantibodies. This protein is cytotoxic and is often used in research related to Native Proteins & Antigens. Its unique properties make it a valuable tool for studying various biological processes.Purity:Min. 95%VGF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VGF antibody, catalog no. 70R-6218
Purity:Min. 95%CYP1A2 antibody
The CYP1A2 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the CYP1A2 protein, which plays a crucial role in drug metabolism and detoxification. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CYP1A2 expression in various biological samples.MRM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRM1 antibody, catalog no. 70R-4809Purity:Min. 95%PCBP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCBP1 antibody, catalog no. 70R-1466Purity:Min. 95%ODF2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ODF2 antibody, catalog no. 70R-3915Purity:Min. 95%Armcx1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Armcx1 antibody, catalog no. 70R-8678Purity:Min. 95%IL15 antibody
IL15 antibody was raised in rabbit using E.coli-expressed murine IL-15 as the immunogen.Purity:Min. 95%STAMBPL1 antibody
STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRIgG2a κ Isotype Control Fc fusion protein (allophycocyanin)
Mouse monoclonal IgG2a kappa Isotype Control Fc fusion protein (allophycocyanin)Purity:Min. 95%
