Biochemicals and Reagents

<p>CDK9 antibody was raised in Rabbit using Human CDK9 as the immunogen</p>

<p>The Lamin B2 antibody is a powerful tool in the field of Life Sciences. This Monoclonal Antibody specifically targets and binds to Lamin B2, a protein involved in nuclear envelope structure and stability. By using this antibody, researchers can study the role of Lamin B2 in various cellular processes.</p>

<p>The FSHR antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both monoclonal and polyclonal antibodies. This antibody is colloidal in nature, making it easy to work with in laboratory settings. It has been extensively used for research purposes, particularly in the study of mesenchymal stem cells.</p>

<p>GSK2798745 is a non-selective cation channel activator. It selectively activates the nicotinic acetylcholine receptor and has been shown to inhibit choroidal neovascularization in patients with age-related macular degeneration. GSK2798745 also inhibits pancreatic enzyme secretion, chronic cough, and cancer cell proliferation. The median plasma concentration of GSK2798745 is reached within 2 hours after administration and the half-life is about 4 hours. GSK2798745 does not cross the blood–brain barrier, which may explain its lack of central nervous system side effects.</p>

<p>HADHA antibody was raised in Rabbit using Human HADHA as the immunogen</p>

<p>Norovirus G2 antibody is a monoclonal antibody that specifically targets the G2 strain of norovirus. It is derived from human serum and has been shown to form dimers, which enhance its binding affinity and effectiveness. This antibody works by immobilizing the virus, preventing it from infecting host cells and causing illness. Norovirus G2 antibody is widely used in Life Sciences research for studying the virus and developing diagnostic tools. It can be used in various applications, such as immunoassays, Western blotting, and immunohistochemistry. This antibody has also shown potential therapeutic applications in the treatment of norovirus infections.</p>

<p>Troponin I protein is a vital component of the troponin complex, which plays a crucial role in regulating muscle contraction. It is a protein kinase that phosphorylates specific residues on troponin I, leading to the inhibition of actomyosin ATPase activity and subsequent muscle relaxation. Monoclonal antibodies targeting troponin I have been developed for diagnostic purposes, allowing for the detection and quantification of this protein in blood samples. In addition to its role in muscle physiology, troponin I has also been implicated in various disease processes. For example, elevated levels of troponin I are indicative of cardiac injury and are commonly used as a diagnostic marker for myocardial infarction. Furthermore, autoantibodies against troponin I have been identified in patients with autoimmune disorders such as antiphospholipid syndrome. Overall, troponin I is a versatile protein with important functions in both normal physiology and disease pathology.</p>

<p>The SNX4 antibody is a polyclonal antibody that is widely used in Life Sciences research. It plays a crucial role in various cellular processes, including the regulation of ornithine and the transport of multidrug resistance proteins. This antibody has been extensively studied for its ability to neutralize the activity of growth factors and inhibitors, such as ketamine, transferrin, low-molecular-weight compounds, interferon, collagen, and epidermal growth factor. Its high specificity and affinity make it an ideal tool for studying the function of these molecules in different biological systems. Additionally, the SNX4 antibody can be used in techniques such as immunohistochemistry and Western blotting to detect and quantify the expression levels of target proteins. With its excellent performance and reliability, this antibody is a valuable asset for researchers in various fields.</p>

<p>Purified Polyclonal Histone Deacetylase 6 antibody</p>

<p>ST6GALNAC4 antibody was raised using the middle region of ST6GALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL</p>

<p>Purified recombinant C1D protein (His tag)</p>

<p>Rabbit polyclonal PRMT8 antibody</p>

<p>CD154 antibody was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.</p>

<p>Rabbit Polyclonal Tau antibody (Thr231)</p>

<p>HEXA antibody was raised in Rabbit using Human HEXA as the immunogen</p>

<p>The DNase I antibody is a powerful medicament used in immunohistochemistry. It belongs to the class of Polyclonal Antibodies, which are known for their high specificity and affinity. This antibody specifically targets tyrosine residues on collagen, growth factors, and membrane-spanning polypeptides. It can be used in various Life Sciences applications, including research and diagnostic purposes.</p>

<p>TAF9 antibody was raised in rabbit using the N terminal of TAF9 as the immunogen</p>

<p>The MYB antibody is a monoclonal antibody that specifically targets the MYB protein. It has been extensively studied and proven to be highly effective in various applications. This antibody has been used in research settings to detect MYB expression levels in different cell types, including human hepatocytes. It has also been used to study the role of MYB in cancer development and progression.</p>

<p>LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC</p>

<p>Purified Rabbit polyclonal Tuberin antibody (Ser939)</p>

<p>Rabbit polyclonal GLUR2 antibody (Ser880)</p>

<p>The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.</p>

<p>FAIM antibody was raised using the middle region of FAIM corresponding to a region with amino acids FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK</p>

<p>Cytokeratin 5 antibody was raised in guinea pig using recombinant human keratin K5 as the immunogen.</p>

<p>The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.</p>

<p>Rabbit polyclonal KIT antibody (Tyr936)</p>

<p>Rabbit polyclonal Ceruloplasmin antibody (biotin)</p>

<p>The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.</p>

<p>Purified recombinant SYT3 protein (His tag)</p>

<p>Purified recombinant Human MAPK9 protein (His tag)</p>

<p>Rabbit polyclonal MEK1/MEK2 antibody</p>

<p>HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK</p>

<p>Recombinant human IMPDH2 protein (His tag)</p>

<p>CD23 antibody was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>

<p>Mouse monoclonal SEMA6C antibody</p>

<p>Purified Rabbit polyclonal KCNA3 antibody (Tyr135)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BMP2K antibody, catalog no. 70R-2021</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PON3 antibody, catalog no. 70R-6930</p>

<p>Mycophenolic Acid antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to various proteins, including β-catenin, dopamine, TNF-α, tyrosine kinase receptors, phosphatases, and nuclear factors. This antibody exhibits cytotoxic activity against cells expressing these proteins and has been extensively used in studies involving antigen detection and antibody-drug conjugates. Mycophenolic Acid antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and affinity make it an essential component in many research applications.</p>

<p>KIAA1604 antibody was raised in rabbit using the C terminal of KIAA1604 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC4 antibody, catalog no. 70R-1330</p>

<p>Purified recombinant Human LCN2 protein</p>

<p>35-205 amino acids: MGSSHHHHHH SSGLVPRGSH MLPGVGLTPS AAQTARQHPK MHLAHSTLKP AAHLIGDPSK QNSLLWRANT DRAFLQDGFS LSNNSLLVPT SGIYFVYSQV VFSGKAYSPK ATSSPLYLAH EVQLFSSQYP FHVPLLSSQK MVYPGLQEPW LHSMYHGAAF QLTQGDQLST HTDGIPHLVL SPSTVFFGAF AL</p>

<p>Rabbit Polyclonal Androgen Receptor antibody (Ser213)</p>

<p>Goat polyclonal Pseudomonas aeruginosa Exotoxin A antibody</p>

<p>The STK11 antibody is a highly effective monoclonal antibody that specifically targets and binds to the STK11 protein. This protein plays a crucial role in regulating cell growth and division, making it an important target for cancer research. The STK11 antibody has been extensively tested and proven to be highly specific and sensitive in detecting the presence of STK11 protein in various biological samples.</p>

<p>DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK</p>

<p>The proBNP antibody is a monoclonal antibody that specifically targets proBNP, an important biomarker for heart failure. This antibody is designed to detect and quantify proBNP levels in human serum samples. It has high specificity and sensitivity, allowing for accurate and reliable measurement of proBNP levels.</p>

<p>FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.</p>

<p>Purified recombinant CAPNS1 protein (His tag)</p>

<p>ABCB8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG</p>

<p>Mouse monoclonal CD8b antibody (FITC)</p>

<p>The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.</p>

<p>Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.</p>

<p>Rabbit polyclonal TOR3A antibody</p>

<p>The EBV EBNA protein is a highly versatile and reactive protein that has various applications in the field of Proteins and Antigens. It has been extensively studied and found to have multiple functions. This protein is known to interact with taurine, a key amino acid found in human serum, and it has been shown to exhibit leukemia inhibitory factor (LIF) activity. Additionally, the EBV EBNA protein can be neutralized by specific monoclonal antibodies.</p>

<p>Rabbit polyclonal S1PR2 antibody</p>

<p>The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.</p>

<p>Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY</p>

<p>Rabbit polyclonal hnRNPL antibody</p>

<p>Recombinant human ABO protein</p>

<p>CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen</p>

<p>Mouse monoclonal ARFGAP1 antibody</p>

<p>Rabbit polyclonal SMARCAL1 antibody</p>

<p>The GRP94 antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It specifically targets biomolecules such as interleukins and is commonly used in recombination studies. The GRP94 antibody has a high affinity for its target and is known to effectively bind to interleukin-6, preventing its activity. This antibody can be utilized in different assays to detect and quantify the presence of interleukins in samples. Additionally, it has been observed that the GRP94 antibody can inhibit syncytia formation, a process involving the fusion of cells, which is important in various biological processes. With its antigen binding domain, this monoclonal antibody offers precise and accurate detection capabilities for researchers working with biomolecules and cytokines.</p>

<p>The SSB antibody is a monoclonal antibody that targets specific antigens related to glycosylation, steroids, dopamine, and fibrinogen. This antibody is used in various applications within the field of life sciences. It has been extensively studied for its role in detecting autoantibodies and nuclear antigens, as well as its potential in diagnosing certain conditions. The SSB antibody has also shown promise in research related to brain natriuretic peptide and histidine nuclear isothiocyanate. With its high specificity and reliability, this antibody is a valuable tool for researchers and scientists working in the field of life sciences.</p>

<p>CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10340</p>

<p>C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV</p>

<p>The GPR18 antibody is a highly specialized monoclonal antibody that plays a crucial role in endothelial growth and microvessel density. It specifically targets galectin-3-binding proteins, which are essential for the regulation of immune responses and cell signaling. This antibody has been extensively tested using immunoassays and has shown remarkable specificity and reactivity towards its target.</p>

<p>ACADSB antibody was raised in Rabbit using Human ACADSB as the immunogen</p>

<p>Mouse monoclonal Ly108 antibody (PE)</p>

<p>Purified Polyclonal Septin 7 antibody</p>

<p>TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR</p>

<p>The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.</p>

<p>Factor V antibody (biotin) was raised in sheep using human factor V purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal GJC3 antibody</p>

<p>The Syk antibody is a monoclonal antibody that specifically targets and binds to the Syk protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and signaling. By binding to Syk, the antibody inhibits its activity, which can have significant therapeutic implications.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>ZNF501 antibody was raised in rabbit using the C terminal of ZNF501 as the immunogen</p>

<p>Extracellular Ig-like domain; 22-255 amino acids: MADEEKLPPG WEKRMSRSSG RVYYFNHITN ASQWERPSGN SSSGGKNGQG EPARVRCSHL LVKHSQSRRP SSWRQEKITR TKEEALELIN GYIQKIKSGE EDFESLASQF SDCSSAKARG DLGAFSRGQM QKPFEDASFA LRTGEMSGPV FTDSGIHIIL RTE</p>

<p>The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.</p>

<p>ECHS1 antibody was raised in Rabbit using Human ECHS1 as the immunogen</p>

<p>Recombinant human DHRS9 protein (His tag)</p>

<p>AHSG protein is a cytotoxic protein that belongs to the group of Proteins and Antigens. It is commonly used in research as a recombinant protein and has been shown to have neutralizing effects on colony-stimulating factors. AHSG protein can also act as a phosphatase, regulating cellular signaling pathways. This protein has potential therapeutic applications as an immunosuppressant and has been studied for its ability to inhibit the activity of calmodulin. In human serum, AHSG protein exists as dimers and can be detected using monoclonal antibodies. With its diverse range of properties, AHSG protein is a valuable tool in life sciences research.</p>

<p>The PMVK antibody is a highly specialized antibody that plays a crucial role in the immune response. It is activated by interferon-gamma (IFN-gamma) and exhibits cytotoxic activity against target cells. This antibody specifically targets tyrosine residues on growth factors, leading to their neutralization and inhibition of cell proliferation. Additionally, the PMVK antibody has been shown to bind to annexin proteins, which are involved in apoptotic processes. This monoclonal antibody is produced using cutting-edge technology and is highly specific for its target antigen. It has been widely used in life sciences research, including studies on adenine metabolism and the development of antiviral therapies.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, effectively inhibiting transcription and replication processes in the bacteria. The efficacy of this drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specificity towards Mycobacterium tuberculosis strains makes it a potent weapon against this infectious disease.</p>

<p>The Pax5 antibody is a highly effective monoclonal antibody that targets mesothelin, a protein associated with various cancers. It is widely used in Life Sciences research and has been shown to inhibit the growth of cancer cells by blocking the oncostatin signaling pathway. This antibody specifically binds to mesothelin and prevents its interaction with other proteins, thereby inhibiting tumor growth. Additionally, the Pax5 antibody has been used in studies to detect serum albumin protein and osteopontin levels in cancer patients. It has also been shown to enhance the effects of chemotherapy drugs like taxol by increasing their efficacy against cancer cells. Furthermore, this antibody has potential applications in Alzheimer's disease research as it can bind to amyloid plaques and reduce glutamate-induced neurotoxicity. The Pax5 antibody has also been found to modulate cellular signaling pathways by activating β-catenin and promoting e-cadherin expression. Overall, this high-quality monoclonal antibody offers great promise for both diagnostic</p>

<p>Grp78 antibody was raised in rabbit using a synthetic peptide corresponding to the sequence near the C-terminus of rat Grp78 (BiP) as the immunogen.</p>

<p>Rabbit polyclonal UBASH3A antibody</p>

<p>Gastrin antibody was raised in rabbit using human gastrin 17 conjugated to BSA as the immunogen.</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>HS56 is an advanced biopolymer, which is derived from a proprietary synthesis of renewable sources. With its unique molecular configuration, this product stands out due to its sustainable origin and innovative production method. The mode of action involves its ability to form stable complexes with diverse substrates, which can enhance material properties such as strength, flexibility, and biodegradability.</p>

<p>Purified recombinant PRH1 protein (His tag)</p>

<p>Mouse monoclonal TP53I3 antibody</p>

<p>Purified recombinant JO1 protein</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>IL1a antibody is a monoclonal antibody that specifically targets interleukin-1 alpha (IL-1α), a pro-inflammatory cytokine involved in various immune responses. This antibody can be used for research purposes in the field of life sciences to study the role of IL-1α in different biological processes. IL1a antibody has been shown to inhibit the activity of IL-1α, preventing its interaction with its receptors and subsequent signaling pathways. It can also be used as a therapeutic agent to treat conditions associated with excessive IL-1α activity, such as inflammatory diseases or autoimmune disorders. The high specificity and affinity of this monoclonal antibody make it a valuable tool for scientists and researchers working in immunology, pharmacology, and related fields.</p>

<p>The TRIM33 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to TRIM33 protein, which plays a crucial role in cellular processes. The antibody is made using advanced techniques and high-quality materials to ensure its effectiveness.</p>

<p>Rabbit polyclonal GPR135 antibody</p>