Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,728 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(440 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130509 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Harbi1 antibody
Harbi1 antibody was raised in rabbit using the N terminal of Harbi1 as the immunogenPurity:Min. 95%ALAD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALAD antibody, catalog no. 70R-8516Purity:Min. 95%PBEF1 antibody
PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHVEGF121 protein (His tag)
207-327 amino acids: MGSSHHHHHH SSGLVPRGSH MAPMAEGGGQ NHHEVVKFMD VYQRSYCHPI ETLVDIFQEY PDEIEYIFKP SCVPLMRCGG CCNDEGLECV PTEESNITMQ IMRIKPHQGQ HIGEMSFLQH NKCECRPKKD RARQEKCDKP RRPurity:Min. 95%BCL6B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BCL6B antibody, catalog no. 70R-8459Purity:Min. 95%FasL antibody
FasL antibody was raised in goat using highly pure recombinant human FasL/Apo1L as the immunogen.Purity:Min. 95%SUSD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SUSD4 antibody, catalog no. 70R-6885Purity:Min. 95%RORA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RORA antibody, catalog no. 70R-1937Purity:Min. 95%14-3-3 epsilon antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been proven through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.IQCB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IQCB1 antibody, catalog no. 70R-9889Purity:Min. 95%ZNF385B antibody
ZNF385B antibody was raised in rabbit using the C terminal of ZNF385B as the immunogenPurity:Min. 95%SMC1 antibody
The SMC1 antibody is a polyclonal antibody that specifically targets the glycoprotein SMC1. This antibody is widely used in life sciences research to study various cellular processes and pathways. It has been shown to have binding affinity towards erythropoietin, mitogen-activated protein (MAP) kinases, collagen, fibronectin, and multidrug resistance proteins. Additionally, the SMC1 antibody can detect autoantibodies, interleukin-6, p38 MAP kinase, monoclonal antibodies, chemokines, and steroids. Its versatility and specificity make it an essential tool for researchers in various fields of study.
Purity:Min. 95%PUM2 antibody
PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPADKLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGD
C18orf25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C18orf25 antibody, catalog no. 70R-4005Purity:Min. 95%NAP2 antibody
NAP2 antibody was raised in rabbit using highly pure recombinant hNAP-2 as the immunogen.Purity:Min. 95%SPRY2 antibody
SPRY2 antibody was raised in rabbit using the N terminal of SPRY2 as the immunogenPurity:Min. 95%SERPINB13 antibody
The SERPINB13 antibody is a powerful tool in the field of life sciences. This monoclonal antibody has shown great potential as an antiviral agent, particularly against brain natriuretic peptide (BNP). It works by neutralizing the activity of BNP, which is involved in various physiological processes. The SERPINB13 antibody has been extensively tested and proven to be highly effective in inhibiting the activation of fibrinogen, a key player in blood clotting. Its specificity and high affinity make it an ideal choice for research purposes. With its exceptional properties, this antibody holds great promise for advancing our understanding of various biological pathways and developing novel therapeutic interventions.FANCL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FANCL antibody, catalog no. 70R-3410Purity:Min. 95%HSV2 antibody (FITC)
HSV2 antibody (FITC) was raised in sheep using HSV type 2, strain G as the immunogen.
FAM78A antibody
FAM78A antibody was raised using the N terminal of FAM78A corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVTIPARP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIPARP antibody, catalog no. 70R-3180Purity:Min. 95%EIF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF6 antibody, catalog no. 70R-10307Purity:Min. 95%Rabbit anti Human IgG (HRP)
Rabbit anti-human IgG (HRP) was raised in rabbit using human IgG gamma chain as the immunogen.Purity:Min. 95%ZNF579 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF579 antibody, catalog no. 70R-8138Purity:Min. 95%BTF3 antibody
BTF3 antibody was raised in rabbit using the middle region of BTF3 as the immunogenPurity:Min. 95%SULT1A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1A1 antibody, catalog no. 70R-2618Purity:Min. 95%c-Kit antibody
The c-Kit antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Kit protein, also known as CD117. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival.Purity:Min. 95%SEC14L4 antibody
SEC14L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQPC antibody
The PC antibody is a growth factor that functions as a monoclonal antibody. It binds to specific binding proteins and is commonly used in the field of immunology. This antibody plays a crucial role in the immune response by targeting antigens and promoting the destruction of harmful cells. The PC antibody has been extensively studied and has shown great potential in various applications, including diagnostics and therapeutics. It has also been found to be effective against autoantibodies and cell antibodies, making it an essential tool for researchers in the field. With its high specificity and ability to recognize phosphorylcholine, this antibody offers a valuable resource for studying lipid peroxidation and cytotoxicity. Whether you're conducting research or developing new treatments, the PC antibody is an indispensable tool that can provide accurate and reliable results. Choose polyclonal or monoclonal antibodies based on your specific needs and take advantage of their exceptional performance. Trust in the power of the PC antibody to enhance your experiments and advance your scientific discoveries.KHDRBS3 antibody
KHDRBS3 antibody was raised using the N terminal of KHDRBS3 corresponding to a region with amino acids MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVIDDX5 antibody
DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYVEGFB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VEGFB antibody, catalog no. 70R-9647Purity:Min. 95%Rabbit anti Mouse IgG1 (biotin)
Rabbit anti-mouse IgG1 (biotin) was raised in rabbit using murine IgG1 heavy chain as the immunogen.Purity:Min. 95%EIF2S1 antibody
EIF2S1 antibody was raised using the N terminal of EIF2S1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
ArpT1 antibody
Arp-T1 antibody was raised in Guinea Pig using synthetic N-terminal domain of human Arp-T1 protein coupled to KLH as the immunogen.
Purity:Min. 95%CDC2 antibody
The CDC2 antibody is a highly specialized antibody that targets the activated form of CDC2, a protein involved in cell division and growth. This antibody is widely used in research and clinical applications to study the role of CDC2 in various biological processes. It can be used as an inhibitor to block the activity of CDC2, allowing researchers to investigate its function and potential therapeutic applications. The CDC2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. These antibodies have been extensively tested and validated in Life Sciences research, ensuring their reliability and accuracy. Additionally, the CDC2 antibody has neutralizing capabilities, making it an ideal tool for studying the effects of CDC2 on adipose tissue growth and other cellular processes. Whether you are conducting basic research or developing new therapies, the CDC2 antibody is an essential tool for understanding the intricate mechanisms of cell division and growth regulation.
AP2M1 antibody
The AP2M1 antibody is a monoclonal antibody that specifically targets the AP2M1 protein. This protein plays a crucial role in the regulation of insulin and adiponectin signaling pathways. By binding to the AP2M1 protein, this antibody can modulate the activity of adipocytes and promote the growth factor-mediated signaling cascade.SMS antibody
The SMS antibody is a highly specialized monoclonal antibody that targets CD33, a protein found in the Life Sciences field. This antibody has been extensively studied and proven to be effective in inhibiting the activity of CD33, which plays a crucial role in various cellular processes.
C19ORF24 antibody
C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPCD1b antibody
The CD1b antibody is a highly effective medicament used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to CD1b, a protein involved in immune responses. It has been shown to have collagen-binding properties and can also interact with other molecules such as galectin-3-binding, alpha-fetoprotein, and hyaluronic acid. The CD1b antibody is widely used in research and diagnostic applications, particularly in the study of immune system function and diseases. It can be utilized as a cytotoxic agent for targeted therapy or as an antagonist binding agent to block specific growth factors. Additionally, this antibody has shown potential for use in treating conditions like thrombocytopenia. With its versatile applications and high specificity, the CD1b antibody is a valuable tool in the field of biomedical research.PARP1 antibody
The PARP1 antibody is a highly specific monoclonal antibody that targets phosphorylcholine. It is commonly used in particle chemiluminescence assays to detect the presence of PARP1. This antibody recognizes and binds to the antigen, allowing for accurate detection and quantification of PARP1 levels. It has been extensively validated and is widely recognized as a reliable tool for studying PARP1-related processes. The PARP1 antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It exhibits high affinity and specificity towards its target and has minimal cross-reactivity with other proteins or molecules. Researchers and scientists rely on this antibody to study PARP1 function, protein-protein interactions, and cellular processes such as DNA repair. With its exceptional performance and versatility, the PARP1 antibody is an essential tool for any laboratory conducting research in the field of molecular biology or cell biology.PNRC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNRC2 antibody, catalog no. 70R-3985
Purity:Min. 95%SLC39A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A4 antibody, catalog no. 70R-6696Purity:Min. 95%TMEM16K Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM16K antibody, catalog no. 70R-6573Purity:Min. 95%PNPLA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA1 antibody, catalog no. 70R-2936Purity:Min. 95%PSMD10 antibody
PSMD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVTopoisomerase II antibody
Topoisomerase II antibody was raised in mouse using recombinant human DNA-topoisomerase IIa (N-terminal fragment) as the immunogen.DDX46 antibody
DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL
HRAS like suppressor 3 protein
1-133 amino acids: MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVARSDQV RDVPurity:Min. 95%CDH11 antibody
The CDH11 antibody is a highly effective diagnostic reagent that is used to neutralize the growth factor in microvessel endothelial cells. This monoclonal antibody specifically targets β-catenin, a key protein involved in the formation of epithelial monolayers. By binding to β-catenin, the CDH11 antibody disrupts the protein complex and inhibits its function, leading to a reduction in cell growth and proliferation. This antibody can be used as a therapeutic agent and/or diagnostic reagent for various conditions, including granulosa cell tumors and other diseases characterized by abnormal β-catenin signaling. With its high specificity and potency, the CDH11 antibody is an essential tool for researchers and healthcare professionals alike.WNT9B antibody
WNT9B antibody was raised using the C terminal of WNT9B corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDAcidic hair keratin K31 antibody
acidic hair keratin K31 antibody was raised in Guinea Pig using Complete recombinant human hair (trichocytic) keratin K31 coupled to KLH as the immunogen.Purity:Min. 95%JAK2 antibody
The JAK2 antibody is a highly specialized monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cellular signaling pathways, specifically in the regulation of cytokine receptors. By binding to JAK2, this antibody effectively inhibits its activity and prevents downstream signaling events.
Keratin K19 antibody
Keratin K19 antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 19(aa80-400) expressed in E. coli strain as the immunogen.
KLHL7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL7 antibody, catalog no. 70R-3853Purity:Min. 95%TSR1 antibody
TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVRabbit IgG
Rabbit IgG is a purified immunoglobulin that serves as a valuable tool in life sciences research. It can be used as a cross-linking agent to study protein-protein interactions and to detect specific antigens in various assays. Rabbit IgG has been widely used in studies involving tumor necrosis factor-alpha (TNF-α), microvessel density, growth factors, fatty acids, DNA vaccines, and other medicaments. It can also be used as a primary or secondary antibody for the detection of target proteins in immunohistochemistry, Western blotting, flow cytometry, and other applications. With its high specificity and affinity, Rabbit IgG is an essential component for researchers working with monoclonal antibodies and polymerase chain reactions (PCR).Purity:Min. 95%VEGFR2 antibody
The VEGFR2 antibody is a highly effective biomolecule used in Life Sciences research. It specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2), which plays a crucial role in angiogenesis and blood vessel formation. This antibody is widely used for the detection and quantification of VEGFR2 in various samples, including human serum, pleural fluid, and tissue sections.Purity:Min. 95%CKMM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CKM antibody, catalog no. 70R-1984Purity:Min. 95%PEBP1 antibody
PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
