Biochemicals and Reagents

<p>Rabbit polyclonal RPN1 antibody</p>

<p>The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.</p>

<p>FT-1518 is a potent anticancer inhibitor that targets protein kinases involved in cell cycle regulation and apoptosis. It is an analog of Chinese medicinal compounds that have been used for centuries to treat cancer. FT-1518 has been shown to selectively inhibit the growth of tumor cells, both in vitro and in vivo, while sparing normal cells. This compound has demonstrated significant activity against a range of human cancers, including breast, lung, colon, prostate, and ovarian cancer. FT-1518 inhibits the activity of specific kinases involved in cancer cell proliferation and survival. It has also been found to induce apoptosis in cancer cells by activating caspase-mediated pathways. Moreover, FT-1518 is excreted primarily through urine and has minimal toxicity towards normal cells. Overall, FT-1518 represents a promising new class of kinase inhibitors with potential therapeutic applications for the treatment of various types of cancer.</p>

<p>The USP33 antibody is a polyclonal antibody that is commonly used in life sciences research. It specifically targets the USP33 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying USP33 levels in different samples.</p>

<p>Nexinhib 20 is a pro-inflammatory cytokine inhibitor that inhibits the production of pro-inflammatory cytokines, such as IL-1β and TNFα. It has been shown to be effective in reducing the growth of primary tumor cells and also reduces inflammation in diseases such as cancer, inflammatory bowel disease (IBD), and bowel diseases. Nexinhib 20 is not absorbed well when ingested orally due to its low bioavailability. It is also an acidic protein with a pI of 4.8.</p>

<p>TLE1 antibody was raised in rabbit using the N terminal of TLE1 as the immunogen</p>

<p>Zidovudine (USP grade powder) chemical reference substance</p>

<p>PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ</p>

<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the phosphatase growth factor. It has been specifically designed to neutralize tyrosine and colloidal substances in the body, making it an effective tool for various medical applications. This antibody has shown promising results in inhibiting the activity of glial fibrillary acidic proteins, which are associated with neurodegenerative diseases. Additionally, it has demonstrated its efficacy in targeting and neutralizing the circumsporozoite protein, making it a potential candidate for the development of vaccines against certain infectious diseases. The MCL1 antibody is a valuable asset in the field of medical research and holds great promise for future therapeutic interventions.</p>

<p>Sox2 antibody was raised in rabbit using residues 113-127 [KEHPDYKYRPRRKTK] of the 37 kDa human Sox2 protein as the immunogen.</p>

<p>Rat monoclonal CD24 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL</p>

<p>The FGF1 antibody is a monoclonal antibody that specifically targets the HER2 protein. It belongs to the class of anti-HER2 antibodies, which also includes adalimumab and trastuzumab. This antibody binds to HER2, preventing its interaction with other biomolecules and inhibiting downstream signaling pathways involved in cell growth and division.</p>

<p>The Vimentin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and detect vimentin, an intermediate filament protein that plays a crucial role in maintaining cell structure and integrity. This antibody is particularly useful in research related to amyloid plaque formation, as it can identify activated vimentin in these structures.</p>

<p>The ALDH1L1 antibody is a highly reactive collagen-specific antibody that is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and bind to the activated form of collagen, which is a key component of various biological processes. It can be used for applications such as immobilization and detection of collagen in samples, as well as for studying the role of collagen in different cellular pathways.</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>Purified recombinant WNT7A protein (His tag)</p>

<p>MPP7 antibody was raised in Rabbit using Human MPP7 as the immunogen</p>

<p>Mouse monoclonal SERPINA5 antibody</p>

<p>Rabbit polyclonal TINAGL1 antibody</p>

<p>Rabbit polyclonal SFRS17A antibody</p>

<p>The XRCC5 antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. This antibody is specifically designed to target XRCC5, which is an important protein involved in DNA repair and recombination. The XRCC5 antibody can be used for immobilization on electrodes, making it useful in techniques such as electrochemical immunoassays. Additionally, this antibody has been shown to be effective in detecting hormone peptides, including anti-HBs and c-myc, in human serum samples. It can also be used to study the serotonergic system and investigate the role of XRCC5 in fatty acid metabolism. With its broad range of applications, the XRCC5 antibody is a valuable tool for researchers working in various fields of study within Life Sciences.</p>

<p>AKT2 antibody was raised in rabbit using the middle region of AKT2 as the immunogen</p>

<p>CAMK1D antibody was raised in Rabbit using Human CAMK1D as the immunogen</p>

<p>Penicillin antibody was raised in mouse using penicillin as the immunogen.</p>

<p>Sheep polyclonal Nicarbazin antibody</p>

<p>SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF</p>

<p>BMX-IN-1 is a DNA polymerase inhibitor that has been used in the study of chemical biology. It has been shown to selectively inhibit transcription and replication of pro-inflammatory cytokines, such as tumor necrosis factor-α (TNF-α). The kinetics of BMX-IN-1 have been studied by measuring the inhibition of transcription in vitro. The optimum concentration for BMX-IN-1 was found to be 0.3 μM, which inhibits the synthesis of TNF-α by 58%. BMX-IN-1 also inhibits cancer tissue growth and may be an effective treatment for cancer. This drug is a potential molecular target for cervical cancer.</p>

<p>alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH</p>

<p>Purified recombinant MLLT11 protein (His tag)</p>

<p>WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM</p>

<p>Rabbit polyclonal URM1 antibody</p>

<p>Mouse monoclonal CAPN9 antibody</p>

<p>JTV-519 hemifumarate is a calcium sensitizer, which is a pharmaceutical agent designed to improve cardiac contractility. It is derived from a synthetic process focusing on modulating calcium dynamics within cardiac cells. By binding to and stabilizing the ryanodine receptor (RyR2), JTV-519 hemifumarate enhances calcium release from the sarcoplasmic reticulum during the cardiac cycle. This action leads to an increase in the sensitivity of cardiac myofilaments to calcium without increasing intracellular calcium concentration, thereby improving myocardial contractility without the pro-arrhythmic effects associated with increased calcium transients.</p>

<p>TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP</p>

<p>Rabbit polyclonal S100B antibody (biotin)</p>

<p>The GATA4 antibody is a highly specialized monoclonal antibody that is used in the field of life sciences. It specifically targets the GATA4 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies against GATA4.</p>

<p>IKAP antibody was raised in rabbit using residues 148-161 IHQDDFGESKFITV of human IKAP as the immunogen.</p>

<p>The IGF2BP2 antibody is a highly reactive and neutralizing monoclonal antibody that targets the insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications.</p>

<p>The Aprotinin antibody is a highly specialized and effective tool in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in bioassays, specifically targeting the adeno-associated virus (AAV). This antibody can be used to detect and quantify AAV in various samples, including human serum. Additionally, it has shown potential for use in the detection of alpha-fetoprotein and steroids.</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>Rabbit polyclonal FOXO4 antibody (Ser262)</p>

<p>The LDHA antibody is a monoclonal antibody that is used in the field of life sciences. It specifically targets lactate dehydrogenase A (LDHA), an enzyme involved in the conversion of pyruvate to lactate during anaerobic glycolysis. By inhibiting LDHA, this antibody can help researchers study the role of lactate metabolism in various biological processes. Whether you're conducting research or developing new therapeutic strategies, the LDHA antibody is a valuable tool for understanding and manipulating lactate levels in cells and tissues. Trust in its specificity and reliability to advance your scientific endeavors.</p>

<p>Rabbit polyclonal IL4 antibody (biotin)</p>

<p>PTGER2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Phencyclidine cyclohexyl 4 Conjugate for use in immunoassays</p>

<p>The SIX6 antibody is a growth factor that belongs to the class of polyclonal antibodies. It specifically targets and binds to the SIX6 protein, which plays a crucial role in eye development. The antibody has been extensively studied for its ability to detect and measure the levels of SIX6 in various biological samples.</p>

<p>The HSP60 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the heat shock protein 60 (HSP60), which plays a crucial role in cellular stress response and protein folding. This antibody is widely used in various applications, including immunoblotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified recombinant DAP protein (His tag)</p>

<p>IL1RA antibody was raised in rabbit using highly pure recombinant human IL-1RA as the immunogen.</p>

<p>Purified synthetic Bilirubin Conjugate protein</p>

<p>The Clenbuterol antibody is a monoclonal antibody that has neutralizing properties. It specifically targets and binds to Clenbuterol, a synthetic drug commonly used as a bronchodilator and for its anabolic effects. This antibody effectively blocks the activity of Clenbuterol, preventing it from binding to its target receptors.</p>

<p>Purified Rabbit polyclonal CAPN11 antibody</p>

<p>Purified Rabbit polyclonal EIF5B antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES</p>

<p>Rat monoclonal PLET1 antibody</p>

<p>The TXK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the chemokine known as TXK, which plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in blocking the activation of TXK.</p>

<p>Rabbit Polyclonal IR antibody (Tyr1361)</p>

<p>CA10 antibody was raised in Rabbit using Human CA10 as the immunogen</p>

<p>MAEA antibody was raised in Rabbit using Human MAEA as the immunogen</p>

<p>Purified recombinant MZB1 protein (His tag)</p>

<p>Rabbit polyclonal STK36 antibody</p>

<p>MYH9 antibody was raised using the middle region of MYH9 corresponding to a region with amino acids DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK</p>

<p>The ROR1 antibody is a powerful biomolecule used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and monoclonal antibodies. This antibody specifically targets the receptor tyrosine kinase-like orphan receptor 1 (ROR1). By binding to ROR1, it inhibits its activity and prevents downstream signaling pathways involved in cell growth and survival.</p>

<p>Rabbit polyclonal AOS1 antibody</p>

<p>The SSTR2 antibody is a specific antibody that targets the somatostatin receptor 2 (SSTR2). It is commonly used in research studies involving granulosa cells, as well as in clinical settings for diagnostic purposes. This antibody can be used to detect the presence of SSTR2 in various tissues and cell types. It has also been shown to have potential therapeutic applications, as it can block the activity of SSTR2 and inhibit the growth of certain tumors. The SSTR2 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the option that best suits their needs. Whether you are studying autoantibodies or investigating the role of SSTR2 in disease pathways, this antibody is a valuable tool for your research.</p>

<p>LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN</p>

<p>Rat monoclonal CD8 antibody (FITC); IgG2b kappa</p>

<p>DCUN1D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPTSSGDAGRESKSNAE</p>

<p>Rabbit polyclonal MRPL24 antibody</p>

<p>Creatine kinase (also known as phosphocreatine kinase or creatine phosphokinase, CAS No [9001-15-4], EC 2.7.3.2) in an enzyme that catalyzes the following reaction:creatine + ATP ⇌ phosphocreatine + ADPOne unit of creatine kinase will transfer 1.0 μmole of phosphate from phosphocreatine to ADP per min at 37 °C.Bovine heart creatine kinase comes in lyophilized form as a red powder. It was lyophilized from tris chloride, EDTA and DTT. Its activity is ≥100U/mg, and specific activity is ≥200U/mg protein. Store at -20°C on arrival.</p>

<p>Rabbit polyclonal Synuclein beta antibody</p>

<p>The SQSTM1 antibody is a cytotoxic agent used in Life Sciences research. It is commonly used to study the function of annexin A2, an important protein involved in various cellular processes. This antibody can be utilized in experiments such as immunofluorescence and Western blotting to detect the presence of SQSTM1 protein. Additionally, it has applications in clinical diagnostics for detecting autoantibodies against insulin and alpha-fetoprotein. The SQSTM1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying various biological phenomena related to insulin regulation and cell signaling pathways.</p>

<p>The APP antibody is a highly reactive monoclonal antibody used in Life Sciences. It is specifically designed to detect and bind to the amyloid precursor protein (APP), a glycoprotein involved in the growth factor signaling pathway. This antibody is commonly used in research and diagnostic applications to study the role of APP in various cellular processes.</p>

<p>Rabbit polyclonal MRP7 antibody</p>

<p>Rabbit polyclonal STAT6 antibody (Tyr641)</p>

<p>Rabbit Polyclonal KCNB1 antibody (Ser567)</p>

<p>Purified Rabbit polyclonal GRB7 antibody</p>

<p>Purified recombinant TSR2 protein (His tag)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>B3galnt1 antibody was raised in rabbit using the C terminal of B3galnt1 as the immunogen</p>

<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR</p>

<p>Purified Polyclonal FXYD2 antibody</p>

<p>The GFAP antibody is a neutralizing monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). GFAP is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody has been extensively studied in Life Sciences and has shown promising results in various applications.</p>

<p>The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.</p>

<p>Rabbit polyclonal RND3 antibody</p>

<p>Rabbit polyclonal PKC theta antibody (Tyr52)</p>

<p>Mouse monoclonal C9orf41 antibody</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Mouse monoclonal CTAG1B antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth.</p>

<p>The CD11c antibody is a monoclonal antibody that specifically targets the CD11c protein. This protein is involved in various biological processes, including immune response and cell adhesion. The CD11c antibody has been extensively studied for its potential applications in the field of Life Sciences.</p>

<p>Purified Polyclonal BNIP2 antibody</p>

<p>The PODXL antibody is a highly specialized monoclonal antibody that targets the glycoprotein known as podocalyxin-like protein (PODXL). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal SFRS9 antibody</p>