Biochemicals and Reagents

Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

p38 MAP kinase antagonist

Catalogue peptide; min. 95% purity

Amyloid beta protein is a peptide that is a major component of the amyloid plaques found in the brain of patients with Alzheimer's disease. Amyloid beta protein (Aβ) has been shown to form fibers and fibrils, which are aggregates of polymerized Aβ peptides. These fibrils can be imaged using a fluorescent dye called dansyl. The dansyl-labeled Aβ fibrils have been shown to have a morphology similar to that seen in electron micrographs of amyloid plaques. The quantum yield for luminescence was found to be 0.1% for the Aβ fibrils but only 0.001% for the monomeric form of Aβ peptides (Aβ 1-40). This suggests that the Aβ peptides are undergoing aggregation into amyloid beta protein fibrils before they can emit light as fluorescence or phosphorescence.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

BIBF 1202 is a potent inhibitor of phospholipase A2, prostaglandin synthase and cyclooxygenase-2. It inhibits the production of arachidonic acid from membrane phospholipids and is used in cancer research. BIBF 1202 has been shown to have anti-tumour activity in a number of animal models, including human liver cancer cells. This molecule has also been shown to inhibit the activation of nuclear factor kappa B (NF-κB), which is involved in carcinogenesis.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Perfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate is a synthetic compound, which is derived through a series of complex organic syntheses involving perfluorinated reagents. This compound is meticulously designed to incorporate both perfluorinated aromatic groups and a flexible, polyether-based linker. The mode of action for this compound primarily revolves around its unique chemical structure, which facilitates interactions at the molecular level that can be favorable for a variety of biochemical applications.

Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

AG-270 is a small molecule that binds to the extracellular domain of the human angiotensin II type 1 receptor. It inhibits the receptor from binding with angiotensin II and prevents the activation of downstream signaling pathways, thereby blocking the effects of angiotensin II. AG-270 is a research tool that can be used in cell biology and pharmacology studies.

Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Catalogue peptide; min. 95% purity

Please enquire for more information about Amyloid beta-Protein (22-35) including the price, delivery time and more detailed product information at the technical inquiry form on this page

WS-12 is a low-potency antimicrobial agent that inhibits bacterial growth by disrupting the microbial membrane and cell wall. WS-12 is an aryl halide with a cationic side chain that binds to activated filaments, which disrupts the function of the cell membrane. The exact mechanism of how WS-12 interacts with cells is not known, but it has been shown to alter neuronal function, cause growth inhibition in cancer cells, and inhibit the polymerase chain reaction.

H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.

H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.

Catalogue peptide; min. 95% purity

Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.

The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes

Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.

Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.

Fluorescent derivative of cyclopamine

Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.

8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.

Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page

FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).

Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.

L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.

Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fentanyl p Conjugate for use in immunoassays

1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.

S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing

Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page

a brain-penetrating activator of eukaryotic initiation factor 2B (eIF2B) that inhibits the abnormal integrated stress response

L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.

CB-1158 is an arginase inhibitor, which is a small molecule derived from a synthetic source designed to modulate immune functions. Its mode of action involves the inhibition of the arginase enzyme, a key player in the urea cycle responsible for the hydrolysis of arginine into ornithine and urea. By blocking arginase, CB-1158 effectively prevents the depletion of extracellular arginine, a vital amino acid required for the activation and proliferation of T cells within the immune system. This inhibition leads to enhanced immune responses against tumors.

Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab

Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.
There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.
Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.
Parainfluenza Virus Type 2 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-2 infection. It can also be used as a research tool in vaccine development.