Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SCRT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCRT2 antibody, catalog no. 70R-8980
Purity:Min. 95%TPRKB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TPRKB antibody, catalog no. 70R-4344Purity:Min. 95%Goat anti Mouse IgM (HRP)
Goat anti-mouse IgM (HRP) was raised in goat using murine IgM mu chain as the immunogen.Purity:By ImmunoelectrophoresisCD153 antibody
The CD153 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD153, a protein expressed on pluripotent stem cells. This antibody can be used in various research assays and experiments to study the function and behavior of pluripotent stem cells.Hepatitis C Virus NS5 protein
The E.coli derived recombinant protein contains the HCV NS5 immunodominant regions, amino acids 2061-2302. The protein is fused with GST at N-terminus.Purity:Min. 95%EXOSC10 antibody
EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGLCK antibody
The LCK antibody is a powerful cytotoxic agent that specifically targets the LCK receptor. It has been extensively studied and proven to have high affinity binding to the LCK receptor, making it an effective medicament for various applications. The LCK antibody can be used in research laboratories as well as in clinical settings.Purity:Min. 95%MEK2 antibody
The MEK2 antibody is a polyclonal antibody used in life sciences research. It specifically targets and binds to MEK2, a protein involved in the TGF-beta signaling pathway. This antibody can be used to study various cellular processes, including collagen synthesis, growth factor signaling, and cell proliferation. The MEK2 antibody has been extensively validated for use in multiple applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and sensitivity make it an ideal tool for researchers studying the role of MEK2 in different biological systems. With its wide range of applications and reliable performance, the MEK2 antibody is an essential component of any laboratory focused on understanding cellular signaling pathways.Purity:Min. 95%S100 antibody
The S100 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a phosphatase and interacts with other proteins such as erythropoietin, interleukin-6, actin, collagen, fibrinogen, and β-catenin. This antibody is widely used in the field of Life Sciences for research purposes.Goat anti Bovine IgG (FITC)
Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%STAT3 antibody
STAT3 antibody was raised in Mouse using a purified recombinant fragment of STAT3 expressed in E. coli as the immunogen.GDNF protein
Region of GDNF protein corresponding to amino acids MSPDKQAAAL PRRERNRQAA AASPENSRGK GRRGQRGKNR GCVLTAIHLN VTDLGLGYET KEELIFRYCS GSCEAAETMY DKILKNLSRS RRLTSDKVGQ ACCRPVAFDD DLSFLDDSLV YHILRKHSAK RCGCI.Purity:Min. 95%Human IgG antibody
The Human IgG antibody is a powerful inhibitory factor that targets various proteins and factors in the body. It has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other cytokines involved in immune response regulation. This Monoclonal Antibody specifically binds to alpha-fetoprotein, autoantibodies, and antiphospholipid antibodies, neutralizing their effects. Additionally, it has been found to have a significant impact on interferon signaling pathways.BTN1A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BTN1A1 antibody, catalog no. 70R-7235Purity:Min. 95%CDCA2 antibody
The CDCA2 antibody is a highly effective protein kinase inhibitor that belongs to the family of kinase inhibitors. It is used in the field of Life Sciences as a valuable tool for studying various cellular processes. The CDCA2 antibody specifically targets TGF-beta, which is a key signaling molecule involved in cell growth and differentiation. This antibody can be used in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. In addition to its use as a research tool, the CDCA2 antibody has also shown potential therapeutic applications, particularly in the field of regenerative medicine. It has been found to enhance the differentiation potential of mesenchymal stem cells and promote tissue regeneration. With its ability to inhibit specific kinases and modulate important cellular pathways, the CDCA2 antibody is an indispensable tool for researchers in various fields of study.Netrin 1 antibody
The Netrin 1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Netrin 1, a protein involved in various cellular processes. It has been extensively tested and validated for its high specificity and affinity towards Netrin 1.Fkrp Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fkrp antibody, catalog no. 70R-8609Purity:Min. 95%MED31 antibody
MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNRALY antibody
RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGCP3 antibody
The GCP3 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and exhibits strong antigen-antibody reaction capabilities. This antibody is particularly effective in quantitating growth factors and neutralizing reactive substances in adipose tissues. With its unique properties, the GCP3 antibody can be used as a powerful tool for researchers and clinicians alike.Apelin antibody
The Apelin antibody is a multidrug that belongs to the class of Polyclonal Antibodies. It targets apelin, which is a growth factor involved in various physiological processes. The antibody can be used for research purposes in the field of Life Sciences, particularly in studies related to lipase activity, adipose tissue function, and cell signaling pathways. It has been shown to have potential therapeutic applications in the treatment of conditions such as obesity and cardiovascular diseases. The Apelin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs. With its ability to detect and bind to apelin with high specificity and sensitivity, this antibody is an invaluable tool for studying the role of apelin in various biological processes.SLC36A3 antibody
SLC36A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIHIKB α antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. Known for its bactericidal activity, this drug effectively treats tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Metabolized through different metabolic transformations, including hydrolysis and oxidation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.Streptavidin (PE)
Streptavidin (PE) is a monoclonal antibody that is commonly used in Life Sciences research. It is often conjugated with other proteins and antigens for various applications. Streptavidin (PE) has a high affinity for biotin, making it an excellent tool for detecting and quantifying biotinylated molecules. This antibody can be used in a wide range of experiments, including immunofluorescence staining, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). Additionally, Streptavidin (PE) has been shown to have neutralizing effects on certain growth factors and chemokines, making it a valuable tool in cell culture studies. Its reactive properties also make it useful in electrode-based assays and mitochondrial superoxide detection. With its versatility and reliability, Streptavidin (PE) is an essential component in many research laboratories worldwide.Purity:Min. 95%ASCL4 antibody
ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogenPurity:Min. 95%HNF4 alpha antibody
The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.GAPDH Blocking Peptide
The GAPDH Blocking Peptide is a versatile biomolecule that can be used in various life science applications. This peptide is designed to block the binding of proteins, such as chemokines and growth factors, to GAPDH (Glyceraldehyde-3-phosphate dehydrogenase). By preventing this interaction, the peptide inhibits downstream signaling pathways and cellular processes.
Purity:Min. 95%RAB8B antibody
RAB8B antibody was raised in rabbit using the C terminal of RAB8B as the immunogenPurity:Min. 95%Goat anti Human IgG (H + L) (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%GLS2 antibody
GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFDAAM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DAAM1 antibody, catalog no. 70R-2236
Purity:Min. 95%HDAC5 antibody
The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.PPIH protein
1-177 amino acids: MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV MRKIENVPTG PNNKPKLPVV ISQCGEMPurity:Min. 95%SOX17 antibody
The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.IP10 antibody
IP10 antibody was raised in rabbit using highly pure recombinant rat IP-10 as the immunogen.Purity:Min. 95%KAP11.1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KRTAP11-1 antibody, catalog no. 70R-3239
Purity:Min. 95%ERLIN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN1 antibody, catalog no. 70R-7393Purity:Min. 95%TFEB antibody
The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.Helicobacter pylori antibody
The Helicobacter pylori antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the helicobacter bacteria, allowing for the detection and study of this pathogen. The antibody can be used in various applications, such as immunoassays and immunohistochemistry, to identify and quantify the presence of helicobacter in samples. Additionally, this antibody has been shown to have cytotoxic effects on helicobacter cells, making it a valuable tool for studying the mechanisms of bacterial infection and developing new therapeutic strategies. With its high specificity and affinity, the Helicobacter pylori antibody is an essential component in research related to infectious diseases and microbiology.CD18 antibody
CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.ERC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ERC1 antibody, catalog no. 70R-9796Purity:Min. 95%NFkB p65 antibody
The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.FZD6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD6 antibody, catalog no. 70R-7308Purity:Min. 95%Polacrilin Potassium
Polacrilin Potassium (USP grade powder) chemical reference substancePurity:Min. 95%MMP24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP24 antibody, catalog no. 70R-6357Purity:Min. 95%POLK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLK antibody, catalog no. 70R-5522Purity:Min. 95%MAP2K3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K3 antibody, catalog no. 70R-2684Purity:Min. 95%ALOX15B antibody
ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRC2ORF29 antibody
C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQIGoat anti Human IgG (gamma chain)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%Goat anti Bovine IgG (H + L)
Goat anti-bovine IgG (H + L) was raised in goat using ovine IgG (H & L) as the immunogen.
Purity:Min. 95%MGC50273 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC50273 antibody, catalog no. 70R-4290Purity:Min. 95%Rabbit anti Mouse IgG3 (HRP)
Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.RNF121 antibody
RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATGCARS antibody
CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD
RPS13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS13 antibody, catalog no. 70R-3005Purity:Min. 95%ApoE4 protein
Region of ApoE4 protein corresponding to amino acids MKVEQAVETE PEPELRQQTE WQSGQRWELA LGRFWDYLRW VQTLSEQVQE ELLSSQVTQE LRALMDETMK ELKAYKSELE EQLTPVAEET RARLSKELQA AQARLGADME DVRGRLVQYR GEVQAMLGQS TEELRVRLAS HLRKLRKRLL RDADDLQKRL AVYQAGAREG AERGLSAIRE RLGPLVEQGR VRAATVGSLA GQPLQERAQA WGERLRARME EMGSRTRDRL DEVKEQVAEV RAKLEEQAQQ IRLQAEAFQA RLKSWFEPLV EDMQRQWAGL VEKVQAAVGT SAAPVPSDNH.Purity:≥ 90% By Sds-Page Gel And Hplc AnalysesIL1F5 antibody
IL1F5 antibody was raised in rabbit using the C terminal of IL1F5 as the immunogenPurity:Min. 95%NMUR2 antibody
NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVTYRP1 antibody
TYRP1 antibody was raised using the N terminal of TYRP1 corresponding to a region with amino acids AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFELK1 antibody
ELK1 antibody was raised in Mouse using a purified recombinant fragment of ELK1 expressed in E. coli as the immunogen.
