Biochemicals and Reagents

<p>MAPK6 antibody was raised in Rabbit using Human MAPK6 as the immunogen</p>

<p>Purified recombinant YOD1 protein (His tag)</p>

<p>PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV</p>

<p>JPH203 is a compound that has been shown to inhibit the growth of hypoxic tumor cells. It was found to induce apoptosis in tubule cells through a number of mechanisms, including the inhibition of cyclin D2 protein synthesis and the disruption of cellular signaling pathways. JPH203 is structurally similar to organic anion transporters (OATs), which are drug transporters in the body. This property may help it to cross the blood-brain barrier and reach tumors in the brain. JPH203 has also been shown to inhibit cancer cell proliferation and induce apoptosis in colorectal adenocarcinoma cells, as well as inhibiting tumor growth in animal models.</p>

<p>DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS</p>

<p>Rabbit polyclonal SRP9 antibody</p>

<p>The GOLM1 antibody is an active agent in the field of Life Sciences. It belongs to the class of antibodies and has shown promising results in various studies. This antibody specifically targets GOLM1, a glycoprotein that is involved in several cellular processes.</p>

<p>Rabbit polyclonal COX5B antibody</p>

<p>Purified recombinant MT3 protein (His tag)</p>

<p>The GAP43 antibody is a glycopeptide that acts as a neutralizing agent against phosphatase. It is commonly used in ophthalmic formulations and has shown efficacy in reducing inflammation caused by chemokines like TNF-α. This polyclonal antibody is widely used in life sciences research to study biomolecules, particularly in the field of antibodies. The GAP43 antibody has also been found to interact with epidermal growth factor, histidine, erythropoietin, and other growth factors. Additionally, it has been shown to affect microvessel density, making it a valuable tool for studying angiogenesis.</p>

<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA</p>

<p>Rabbit polyclonal SNF8 antibody</p>

<p>PSMD9 antibody was raised in rabbit using the middle region of PSMD9 as the immunogen</p>

<p>INF2 antibody was raised in Rabbit using Human INF2 as the immunogen</p>

<p>TNFRSF6B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to TNFRSF6B, a member of the tumor necrosis factor receptor superfamily. This antibody is widely used in various assays and experiments to study the role of TNFRSF6B in different biological processes.</p>

<p>Mouse monoclonal CD163 antibody (PE)</p>

<p>Rabbit polyclonal MSX2 antibody</p>

<p>MLF2 antibody was raised using the C terminal of MLF2 corresponding to a region with amino acids WRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRR</p>

<p>FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK</p>

<p>DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF</p>

<p>CYP4V2 antibody was raised using the middle region of CYP4V2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI</p>

<p>KLHL21 antibody was raised in Rabbit using Human KLHL21 as the immunogen</p>

<p>MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL</p>

<p>The CTNNB1 antibody is a monoclonal antibody that is used in immunochemical staining assays. It specifically targets the CTNNB1 protein, which plays a crucial role in pluripotent stem cell maintenance and differentiation. This antibody has a high molecular weight cut-off, allowing it to effectively detect and bind to the CTNNB1 protein in various biological samples. The CTNNB1 antibody can be used in a variety of applications, including Western blotting, immunohistochemistry, immunofluorescence, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it an ideal tool for researchers studying the function and expression of the CTNNB1 protein in different biological contexts. With its reliable performance and accurate results, the CTNNB1 antibody is an essential component for any laboratory conducting studies on pluripotent stem cells or related research areas.</p>

<p>Cdx1 antibody was raised in rabbit using the C terminal of Cdx1 as the immunogen</p>

<p>HHV6 gp60/gp100 antibody was raised in mouse using 60/110 KDa envelope glycoprotein of HHV6 as the immunogen.</p>

<p>C13ORF8 antibody was raised in rabbit using the middle region of C13ORF8 as the immunogen</p>

<p>EPM2A antibody was raised in mouse using recombinant human EPM2A (243-331aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal FSHB antibody</p>

<p>OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL</p>

<p>The GRK2 antibody is a monoclonal antibody that targets the G protein-coupled receptor kinase 2 (GRK2). This antibody has shown efficacy in neutralizing the effects of GRK2, which plays a crucial role in various cellular processes. It has been found to inhibit the activation of growth factors and mesenchymal stem cells, making it a potential therapeutic option for conditions related to abnormal cell growth. Additionally, the GRK2 antibody has been studied for its potential anticoagulant properties, as it can bind to fatty acids and antiphospholipid antibodies, reducing their plasma levels. This specific antibody shows promise in the field of Life Sciences and may have applications in treating conditions such as insulin resistance and complications associated with oral contraceptives.</p>

<p>LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN</p>

<p>Purified recombinant Human GOT2 protein (His tag)</p>

<p>The IGJ antibody is a monoclonal antibody that specifically targets insulins. It is cytotoxic and works by binding to insulin molecules, rendering them inactive. This colloidal antibody has neutralizing properties, meaning it can effectively counteract the effects of autoantibodies that may be present in the body. The IGJ antibody is designed to target specific amino acid residues on insulin, ensuring precise and effective binding. It has been extensively tested in Life Sciences research and has shown high affinity for insulin in human serum samples. With its histidine-rich structure, this monoclonal antibody offers a reliable tool for studying insulin-related processes and mechanisms.</p>

<p>Rabbit polyclonal CCL2 antibody (FITC)</p>

<p>The SAA1 Antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to immobilize and detect specific human proteins, making it an essential tool for research and diagnostic purposes. This Monoclonal Antibody is specifically activated to bind to amyloid protein, which is reactive and often associated with various diseases.</p>

<p>The POR antibody is a monoclonal antibody that specifically targets the enzyme POR (P450 oxidoreductase). It is a chimeric protein that has been designed to bind to and inhibit the activity of POR. The antibody has been shown to have high affinity for POR and effectively neutralizes its function.</p>

<p>LDOC1 antibody was raised in mouse using recombinant Human Leucine Zipper, Down-Regulated In Cancer 1 (Ldoc1)</p>

<p>Clostridium difficile Toxin A protein</p>

<p>Purified recombinant HHEX protein (His tag)</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>KCNJ1 antibody was raised in Rabbit using Human KCNJ1 as the immunogen</p>

<p>POGK antibody was raised in rabbit using the middle region of POGK as the immunogen</p>

<p>Rabbit polyclonal PEA15 antibody (Ser116)</p>

<p>IL19 antibody was raised in rabbit using highly pure recombinant human IL-19 as the immunogen.</p>

<p>Conjugated Cotinine-BSA</p>

<p>The LGALS3BP antibody is a powerful inhibitor that targets a specific antigen. This monoclonal antibody has been extensively studied and proven effective in various assays, including immunohistochemistry. It specifically binds to annexin A2, a protein involved in cell signaling and membrane organization.</p>

<p>Ku80 antibody was raised in rabbit using residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein as the immunogen.</p>

<p>WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN</p>

<p>FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG</p>

<p>NAP1L1 antibody was raised in mouse using recombinant Human Nucleosome Assembly Protein 1-Like 1</p>

<p>Florfenicol Amine Conjugate for use in immunoassays</p>

<p>The SOD3 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Superoxide Dismutase 3 (SOD3), an enzyme involved in oxidative stress regulation. This antibody can be used as a research tool to study the role of SOD3 in various biological processes.</p>

<p>Mouse monoclonal 14-3-3 alpha/beta antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (PE)</p>

<p>Full length1-638 amino acids: MGKIIGIDLG TTNSCVAIMD GTTPRVLENA EGDRTTPSII AYTQDGETLV GQPAKRQAVT NPQNTLFAIK RLIGRRFQDE EVQRDVSIMP FKIIAADNGD AWVEVKGQKM APPQISAEVL KKMKKTAEDY LGEPVTEAVI TVPAYFNDAQ RQATKDAGRI AGLEVKRIIN EPTAAALAYG LDKGTGNRTI AVYDLGGGTF DISIIEIDEV DGEKTFEVLA TNGDTHLGGE DFDSRLINYL VEEFKKDQGI DLRNDPLAMQ RLKEAAEKAK IELSSAQQTD VNLPYITADA TGPKHMNIKV TRAKLESLVE DLVNRSIEPL KVALQDAGLS VSDIDDVILV GGQTRMPMVQ KKVAEFFGKE PRKDVNPDEA VAIGAAVQGG VLTGDVKDVL LLDVTPLSLG IETMGGVMTT LIAKNTTIPT KHSQVFSTAE DNQSAVTIHV LQGERKRAAD NKSLGQFNLD GINPAPRGMP QIEVTFDIDA DGILHVSAKD KNSGKEQKIT IKASSGLNED EIQKMVRDAE ANAEADRKFE ELVQTRNQGD HLLHSTRKQV EEAGDKLPAD DKTAIESALT ALETALKGED KAAIEAKMQE LAQVSQKLME IAQQQHAQQQ TAGADASANN AKDDDVVDAE FEEVKDKK</p>

<p>Recombinant Human FGG protein (His tag)</p>

<p>Purified recombinant HSPE1 protein (His tag)</p>

<p>CASK antibody was raised in Rabbit using Human CASK as the immunogen</p>

<p>The CDC7 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets CDC7, a protein kinase involved in the regulation of cell cycle progression and DNA replication. This antibody can be used for various applications, such as immunofluorescence, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal SEC22B antibody</p>

<p>Please enquire for more information about 2-Amino-7-(hydroxymethyl)-4(3H)-pteridinone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS</p>

<p>TG02 is a high-purity synthetic peptide that acts as an activator of the protein receptor. TG02 can be used as a research tool for cell biology and pharmacology studies. It has been shown to activate ion channels and ligand-gated ion channels, including nicotinic acetylcholine receptors, 5-HT3 receptors, NMDA receptors, and GABA A receptors. TG02 also has been shown to inhibit the activity of Ligands that bind to these same protein receptor. TG02 is a small molecule that binds to the GluR2 subunit of the AMPA receptor in rat brain tissue with an IC 50 value of 0.27 μM.</p>

<p>Rabbit polyclonal Synaptotagmin antibody (Thr202)</p>

<p>The AIF antibody is a monoclonal antibody that specifically targets the apoptosis-inducing factor (AIF). This antibody has been widely used in life sciences research to study the role of AIF in various cellular processes. It acts as a neutralizing agent, inhibiting the activity of AIF and preventing its interaction with other proteins in the cell. The AIF antibody has shown promise as a potential therapeutic agent for diseases involving abnormal cell growth, such as cancer. Its ability to bind to specific antigens makes it a valuable tool for researchers studying protein complexes and signaling pathways. Additionally, this antibody has been found to interact with other molecules involved in lipid metabolism, insulin-like growth factor signaling, and nuclear receptors such as the mineralocorticoid receptor.</p>

<p>HKR1 antibody was raised in rabbit using the N terminal of HKR1 as the immunogen</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>NUDT21 antibody was raised in mouse using recombinant Human Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (Nudt21)</p>

<p>Mouse monoclonal CD235a antibody (biotin)</p>

<p>OVA conjugated Cholic acid Hapten</p>

<p>Rabbit polyclonal OR9G4 antibody</p>

<p>The RPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study insulin and its related functions. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most appropriate option for their specific needs.</p>

<p>Fgf3 antibody was raised in rabbit using the C terminal of Fgf3 as the immunogen</p>

<p>EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE</p>

<p>Rabbit polyclonal RPL10A antibody</p>

<p>Rabbit polyclonal LATS antibody (Thr1079/1041)</p>

<p>INTS4 antibody was raised in Rabbit using Human INTS4 as the immunogen</p>

<p>RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN</p>

<p>GNL2 antibody was raised in Rabbit using Human GNL2 as the immunogen</p>

<p>CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.</p>

<p>Purified Rabbit polyclonal OR5M9 antibody</p>

<p>ZBTB9 antibody was raised in rabbit using the C terminal of ZBTB9 as the immunogen</p>

<p>C5ORF24 antibody was raised using the middle region of C5Orf24 corresponding to a region with amino acids SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>CD33 Monoclonal Antibody (RPE)</p>

<p>Rabbit polyclonal ST7L antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Rabbit polyclonal ZNF394 antibody</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>TAAR5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>HAS1 antibody was raised in Mouse using a purified recombinant fragment of human HAS1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal POLR1B antibody</p>

<p>Purified Polyclonal VWA5A antibody</p>

<p>The SLUG antibody is a monoclonal antibody that specifically targets a molecule called SLUG. It has cytotoxic properties, meaning it can kill cells that express SLUG. This antibody has been extensively studied and shown to be effective in various applications.</p>

<p>MYL1 antibody was raised in Rabbit using Human MYL1 as the immunogen</p>

<p>Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL</p>

<p>LCORL antibody was raised in Rabbit using Human LCORL as the immunogen</p>

<p>Neuromedin U antibody was raised in rabbit using synthetic neuromedin U-8, porcine sequence, conjugated to BSA as the immunogen.</p>