Biochemicals and Reagents

H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fluorescent derivative of cyclopamine

8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.

The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes

ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.

S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing

Fentanyl p Conjugate for use in immunoassays

Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.

Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page

L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.

L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.