Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,726 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(439 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD154 antibody
CD154 antibody is a protein that belongs to the class of polyclonal antibodies. It is used in the field of Life Sciences as an inhibitor of epidermal growth factor (EGF). CD154 antibody specifically binds to CD154, a protein expressed on the surface of activated T cells. This binding prevents the interaction between CD154 and its receptors, leading to the inhibition of T cell activation and subsequent immune responses. CD154 antibody has also been shown to inhibit the activity of dopamine β-hydroxylase, an enzyme involved in the synthesis of norepinephrine. Additionally, it has been demonstrated to bind to liver microsomes and modulate their function. CD154 antibody can be used as a monoclonal antibody for various research purposes, including studying protein-protein interactions, identifying binding proteins, and investigating hydration dynamics. Its unique properties make it a valuable tool in the field of Life Sciences.SMPDL3B antibody
SMPDL3B antibody was raised using the N terminal of SMPDL3B corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFPurity:Min. 95%SLC25A21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A21 antibody, catalog no. 70R-6492Purity:Min. 95%RFC3 antibody
RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLPurity:Min. 95%ZNF781 antibody
ZNF781 antibody was raised in rabbit using the N terminal of ZNF781 as the immunogenPurity:Min. 95%SAE1 antibody
SAE1 antibody is a medicament that acts as an inhibitor of growth factors in adipose tissue. It is an antibody that specifically targets SAE1, a protein involved in various cellular processes. This polyclonal antibody has neutralizing properties, meaning it can block the activity of SAE1 and its associated pathways. In the field of Life Sciences, SAE1 antibody is widely used for research purposes, particularly in the study of adipose tissue and its role in metabolic disorders. It has also been shown to have potential therapeutic applications in diseases such as obesity and diabetes. With its ability to target specific proteins and pathways, SAE1 antibody offers new possibilities for understanding and treating various health conditions.
Apbb1 antibody
Apbb1 antibody was raised in rabbit using the N terminal of Apbb1 as the immunogen
Purity:Min. 95%ARMC8 antibody
ARMC8 antibody was raised in rabbit using the N terminal of ARMC8 as the immunogenPurity:Min. 95%Goat anti Mouse IgG (H+L) (PolyCompHRP)
Goat anti-Mouse IgG (H+L) secondary antibody (PolyCompHRP)Purity:Min. 95%Chicken anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%CNTN1 antibody
CNTN1 antibody was raised in rabbit using the middle region of CNTN1 as the immunogenPurity:Min. 95%RBM4 antibody
RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
CCL7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCL7 antibody, catalog no. 70R-7850
Purity:Min. 95%Neuropilin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NETO2 antibody, catalog no. 70R-7424Purity:Min. 95%ZNF555 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF555 antibody, catalog no. 70R-8440Purity:Min. 95%CCDC25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC25 antibody, catalog no. 70R-3622Purity:Min. 95%FAS antibody
FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
ST6GALNAC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC1 antibody, catalog no. 70R-7472Purity:Min. 95%MYD88 antibody
The MYD88 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.S3 12 antibody
S3-12 antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 1394-1410 of human S3-12 as the immunogen.Purity:Min. 95%FHL5 antibody
FHL5 antibody was raised in rabbit using the middle region of FHL5 as the immunogenPurity:Min. 95%AMBP antibody
The AMBP antibody is a monoclonal antibody that targets the colony-stimulating factor and TNF-related apoptosis-inducing ligand (TRAIL). It acts as an inhibitor of these factors, preventing their activity and promoting cell survival. This antibody has been shown to have therapeutic potential in various life sciences applications, including cancer research and treatment. It has also been found to inhibit the growth of microvessels, which may be beneficial in controlling angiogenesis. Additionally, the AMBP antibody has demonstrated its efficacy in modulating immune responses by targeting TNF-α and fibrinogen. Its versatility and specificity make it a valuable tool for researchers in the field of immunology and molecular biology.Dgat2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Dgat2 antibody, catalog no. 70R-8852
Purity:Min. 95%OR2T29 antibody
OR2T29 antibody was raised in rabbit using the C terminal of OR2T29 as the immunogenPurity:Min. 95%CCDC128 antibody
CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENEHAND1 antibody
HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.
Chicken anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%DDX47 antibody
DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQCXCL5 antibody
The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.Met antibody
The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.CACNG4 antibody
CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLPurity:Min. 95%NGAL antibody
The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.
SCGN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCGN antibody, catalog no. 70R-2886Purity:Min. 95%ALS2CR12 antibody
ALS2CR12 antibody was raised in rabbit using the N terminal of ALS2CR12 as the immunogenPurity:Min. 95%CNTNAP3 antibody
CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAPurity:Min. 95%MGC51025 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC51025 antibody, catalog no. 70R-3892
Purity:Min. 95%ZBTB46 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB46 antibody, catalog no. 70R-8970Purity:Min. 95%Goat anti Human κ Chain (Alk Phos)
Goat anti-human kappa chain (Alk Phos) was raised in goat using human k (kappa light chain) as the immunogen.Purity:Min. 95%Tetraspanin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN2 antibody, catalog no. 70R-6131
Purity:Min. 95%Nucleobindin 2 antibody
Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEC3ORF64 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf64 antibody, catalog no. 70R-5375Purity:Min. 95%BACE antibody
BACE antibody was raised in goat using highly pure (>98%) recombinant human BAFF as the immunogen.Purity:Min. 95%Vitronectin antibody (HRP)
Vitronectin antibody (HRP) was raised in sheep using human Vitronectin purified from plasma as the immunogen.NF kappaB p65 antibody
The NF kappaB p65 antibody is a glycoprotein that plays a crucial role in various cellular processes, including the regulation of immune responses and inflammation. It is a mitogen-activated protein that acts as a transcription factor and controls the expression of genes involved in cell survival, proliferation, and differentiation.FADS1 antibody
FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLDiphenhydramine Citrate
Diphenhydramine Citrate (USP grade powder) chemical reference substance
Purity:Min. 95%MMP9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP9 antibody, catalog no. 70R-1574Purity:Min. 95%ITLN2 antibody
ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQACNTF antibody
The CNTF antibody is a polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNTF (Ciliary Neurotrophic Factor), a protein involved in neural development and survival. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.CADM3 antibody
CADM3 antibody was raised in rabbit using the middle region of CADM3 as the immunogenPurity:Min. 95%C1orf96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf96 antibody, catalog no. 70R-3970FHL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FHL3 antibody, catalog no. 70R-8913Purity:Min. 95%TECK antibody
TECK antibody was raised in rabbit using highly pure recombinant human TECK as the immunogen.Purity:Min. 95%G3BP1 antibody
G3BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPPurity:Min. 95%BCAT1 antibody
BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
Purity:Min. 95%Rabbit anti Chicken IgG (Texas Red)
Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(c) fragment as the immunogen.Purity:Min. 95%DOCK2 antibody
DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
Purity:Min. 95%PRL3 protein (His tag)
1-173 amino acids: MGSSHHHHHH SSGLVPRGSH MARMNRPAPV EVSYKHMRFL ITHNPTNATL STFIEDLKKY GATTVVRVCE VTYDKTPLEK DGITVVDWPF DDGAPPPGKV VEDWLSLVKA KFCEAPGSCV AVHCVAGLGR APVLVALALI ESGMKYEDAI QFIRQKRRGA INSKQLTYLE KYRPKQRLRF KDPHTHKTRC CVMPurity:Min. 95%PPID antibody
PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
TIRAP antibody
The TIRAP antibody is a highly specialized monoclonal antibody that targets a specific cell antigen found in human serum. This antibody has been extensively researched and developed in the field of Life Sciences. It has been shown to have neutralizing properties against certain androgen-independent cells, making it a potential therapeutic option for various conditions.NCAM2 antibody
NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILPurity:Min. 95%nNOS antibody
The nNOS antibody is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS). It is commonly used in research and diagnostic applications to detect and quantify the expression of nNOS protein. This antibody binds to the c-myc tag, allowing for easy detection and visualization of the target protein. The nNOS antibody is produced using high-quality hybridoma technology, ensuring consistent and reliable results. It has been extensively validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. With its high specificity and sensitivity, the nNOS antibody is an essential tool for studying the role of nNOS in various physiological and pathological processes.Purity:Min. 95%ADAM15 antibody
ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPurity:Min. 95%
